BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0371.Seq (618 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35921| Best HMM Match : Myelin_PLP (HMM E-Value=8.5) 30 1.3 SB_43678| Best HMM Match : Ribonuclease_BN (HMM E-Value=0.81) 29 2.3 >SB_35921| Best HMM Match : Myelin_PLP (HMM E-Value=8.5) Length = 201 Score = 30.3 bits (65), Expect = 1.3 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +1 Query: 421 SCFLCCRSVL*VFPF*SKLRWSSWETTNRQLKSFTRVCQACSFNLLXVAFWXLI 582 S +C RSV ++ F R+ S +T R L +F RVC+ S + + W + Sbjct: 91 SVAICQRSVRWLYAFKRVCRFVSRQTFMRYLYAFKRVCRFVSRQVGKICHWRFV 144 >SB_43678| Best HMM Match : Ribonuclease_BN (HMM E-Value=0.81) Length = 468 Score = 29.5 bits (63), Expect = 2.3 Identities = 16/52 (30%), Positives = 31/52 (59%) Frame = +2 Query: 293 ISFLPSCFRLAVKVLKILYVTYNNVHALSKISSAILTTXNLTKVVSYVAVAF 448 IS + S FR++ V+ + ++++ ++ ISS I+ T + + V S V V+F Sbjct: 69 ISIVTSIFRISSSVISVFTLSFSVTLVVTVISSVIVVTIS-SSVTSVVKVSF 119 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,018,598 Number of Sequences: 59808 Number of extensions: 271579 Number of successful extensions: 554 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 514 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 554 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -