BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0367.Seq (299 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor p... 29 0.016 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 29 0.016 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 2.5 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 20 7.6 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 20 7.6 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 20 7.6 >AY263366-1|AAO92605.1| 139|Apis mellifera octopamine receptor protein. Length = 139 Score = 28.7 bits (61), Expect = 0.016 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 139 CWNCIHKCCYRQMFWILRCLS-LNQCYW 59 C NCIH + +FW+ C S +N C + Sbjct: 35 CRNCIHPTVFSVLFWLGYCNSAINPCIY 62 Score = 27.5 bits (58), Expect = 0.038 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 253 CWNCIHKCCYRQMYWILRCLS-LNQCYW 173 C NCIH + ++W+ C S +N C + Sbjct: 35 CRNCIHPTVFSVLFWLGYCNSAINPCIY 62 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 28.7 bits (61), Expect = 0.016 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 139 CWNCIHKCCYRQMFWILRCLS-LNQCYW 59 C NCIH + +FW+ C S +N C + Sbjct: 483 CRNCIHPTVFSVLFWLGYCNSAINPCIY 510 Score = 27.5 bits (58), Expect = 0.038 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = -2 Query: 253 CWNCIHKCCYRQMYWILRCLS-LNQCYW 173 C NCIH + ++W+ C S +N C + Sbjct: 483 CRNCIHPTVFSVLFWLGYCNSAINPCIY 510 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.4 bits (43), Expect = 2.5 Identities = 11/38 (28%), Positives = 13/38 (34%) Frame = -2 Query: 169 CRWMIHFHHDCWNCIHKCCYRQMFWILRCLSLNQCYWN 56 CR+ H C C C +M C N WN Sbjct: 737 CRYEAHCFALCHCCDFDACDCEMTCPAGCKCYNDRTWN 774 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 19.8 bits (39), Expect = 7.6 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = -2 Query: 229 CYRQMYWIL 203 C+ MYWI+ Sbjct: 418 CFNLMYWII 426 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 19.8 bits (39), Expect = 7.6 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = -2 Query: 229 CYRQMYWIL 203 C+ MYWI+ Sbjct: 418 CFNLMYWII 426 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 19.8 bits (39), Expect = 7.6 Identities = 5/9 (55%), Positives = 7/9 (77%) Frame = -2 Query: 229 CYRQMYWIL 203 C+ MYWI+ Sbjct: 356 CFNLMYWII 364 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,503 Number of Sequences: 438 Number of extensions: 1517 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 49 effective length of database: 124,881 effective search space used: 6244050 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -