BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0365.Seq (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY604021-1|AAT38515.1| 118|Anopheles gambiae LZ9988P protein. 23 6.3 AY146735-1|AAO12095.1| 149|Anopheles gambiae odorant-binding pr... 23 6.3 >AY604021-1|AAT38515.1| 118|Anopheles gambiae LZ9988P protein. Length = 118 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -1 Query: 255 IIVLSADSRSTPHSCVKCCMTC*IHKVWYLYRDMNL 148 + LSA T S +KC + C K ++ +D L Sbjct: 32 LAALSAKELDTNGSKIKCLVKCFFEKTGFMNKDGQL 67 >AY146735-1|AAO12095.1| 149|Anopheles gambiae odorant-binding protein AgamOBP25 protein. Length = 149 Score = 23.4 bits (48), Expect = 6.3 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -1 Query: 255 IIVLSADSRSTPHSCVKCCMTC*IHKVWYLYRDMNL 148 + LSA T S +KC + C K ++ +D L Sbjct: 56 LAALSAKELDTNGSKIKCLVKCFFEKTGFMNKDGQL 91 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 503,451 Number of Sequences: 2352 Number of extensions: 8536 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -