BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0364.Seq (348 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. 20 6.3 AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. 20 6.3 >X97819-1|CAA66399.1| 251|Tribolium castaneum ZEN Tc protein. Length = 251 Score = 20.2 bits (40), Expect = 6.3 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +1 Query: 166 QKXELQRXQXVGRYXQPMKPLAPVFHSSLQDRSNYLWF 279 Q EL+R G+Y + + + +L +R +WF Sbjct: 99 QLVELEREFHHGKYLSRPRRIQIAENLNLSERQIKIWF 136 >AF321227-4|AAK16424.1| 246|Tribolium castaneum Zen protein. Length = 246 Score = 20.2 bits (40), Expect = 6.3 Identities = 10/38 (26%), Positives = 18/38 (47%) Frame = +1 Query: 166 QKXELQRXQXVGRYXQPMKPLAPVFHSSLQDRSNYLWF 279 Q EL+R G+Y + + + +L +R +WF Sbjct: 90 QLVELEREFHHGKYLSRPRRIQIAENLNLSERQIKIWF 127 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 56,314 Number of Sequences: 336 Number of extensions: 689 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 50 effective length of database: 105,785 effective search space used: 6876025 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -