BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0363.Seq (618 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 4.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 4.2 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.2 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 4.2 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 22 5.5 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.3 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 9.6 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 9.6 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 9.6 AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropi... 21 9.6 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 9.6 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 9.6 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 9.6 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 22.2 bits (45), Expect = 4.2 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = +3 Query: 510 QWQNQIEKDLQDA 548 +W+N+ E D QDA Sbjct: 345 EWENENESDYQDA 357 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +2 Query: 323 RKVKAKTIVFHRKKNLQYYDISAKSNYNFEKPFLWLA 433 +K A+ +V + + A N +PF WLA Sbjct: 193 KKANARAVVLFTRAEDARGILEAARRSNLSQPFQWLA 229 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.2 bits (45), Expect = 4.2 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = +3 Query: 9 TTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGPIRFNVWDTAGQEK 152 T F RH + +++ L +T +G +++ +W G+EK Sbjct: 984 TPFEHRHFISGIDSNLHVYAPLKIS-LDVNTPKGNMQWKIWPMKGEEK 1030 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 4.2 Identities = 10/37 (27%), Positives = 16/37 (43%) Frame = +2 Query: 323 RKVKAKTIVFHRKKNLQYYDISAKSNYNFEKPFLWLA 433 +K A+ +V + + A N +PF WLA Sbjct: 283 KKANARAVVLFTRAEDARGILEAARRSNLSQPFQWLA 319 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.8 bits (44), Expect = 5.5 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -3 Query: 508 DPLNFWWQKGRHGNKLKVTVTN 443 D L+ W Q +H N +KV N Sbjct: 117 DSLSCWLQMTKHHNFIKVCSVN 138 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.4 bits (43), Expect = 7.3 Identities = 6/19 (31%), Positives = 12/19 (63%) Frame = +3 Query: 483 FCHQKFNGSQWQNQIEKDL 539 FC+ + N + W+N + +L Sbjct: 538 FCYFRRNAATWKNAVRHNL 556 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 198 IIMFDVTSRVTYKNVPNWHEIWSVYVK 278 ++ F S V Y+ VP+ ++WS ++ Sbjct: 387 VLGFGYESNVKYQVVPSALQMWSTSLR 413 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -3 Query: 175 YPSLRPPNFSC 143 YP +R P+F C Sbjct: 112 YPGMRAPSFRC 122 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 198 IIMFDVTSRVTYKNVPNWHEIWSVYVK 278 ++ F S V Y+ VP+ ++WS ++ Sbjct: 387 VLGFGYESNVKYQVVPSALQMWSTSLR 413 >AJ780964-1|CAG62942.2| 332|Apis mellifera putative corticotropin releasing hormone-binding protein protein. Length = 332 Score = 21.0 bits (42), Expect = 9.6 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 472 HACPSATRSSMDLNGRTKLKKIFKMHKNTALPEGR 576 H P RSS +K+IF +N A+ E R Sbjct: 140 HQLPLKQRSSEFCGKNIGMKRIFTSSQNIAVIEYR 174 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/27 (29%), Positives = 16/27 (59%) Frame = +3 Query: 198 IIMFDVTSRVTYKNVPNWHEIWSVYVK 278 ++ F S V Y+ VP+ ++WS ++ Sbjct: 13 VLGFGYESNVKYQVVPSALQMWSTSLR 39 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.0 bits (42), Expect = 9.6 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -2 Query: 227 NSRGYVEHDDSTLSLNIVSVSKTTKLLLSGCV 132 +S+ V DD+ ++S++K T ++SG V Sbjct: 401 DSQLLVISDDNIHIKGVISLNKLTSYVISGIV 432 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 9.6 Identities = 6/11 (54%), Positives = 8/11 (72%) Frame = -3 Query: 175 YPSLRPPNFSC 143 YP +R P+F C Sbjct: 112 YPGMRAPSFRC 122 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,472 Number of Sequences: 438 Number of extensions: 4200 Number of successful extensions: 16 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18337950 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -