BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0356.Seq (598 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g33790.1 68415.m04144 pollen Ole e 1 allergen and extensin fa... 32 0.33 At1g26150.1 68414.m03192 protein kinase family protein similar t... 31 0.58 At1g13050.1 68414.m01513 expressed protein 31 0.77 At3g11000.1 68416.m01328 expressed protein 29 2.4 At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family... 29 2.4 At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identica... 29 2.4 At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identica... 29 2.4 At5g07760.1 68418.m00888 formin homology 2 domain-containing pro... 29 3.1 At4g00890.1 68417.m00120 proline-rich family protein contains pr... 29 3.1 At5g48360.1 68418.m05975 formin homology 2 domain-containing pro... 28 5.4 At5g61090.1 68418.m07665 proline-rich family protein contains pr... 27 7.2 At5g13480.1 68418.m01554 WD-40 repeat family protein similar to ... 27 7.2 At2g35640.1 68415.m04371 hydroxyproline-rich glycoprotein family... 27 7.2 At5g57625.1 68418.m07199 allergen V5/Tpx-1-related family protei... 27 9.5 At5g38560.1 68418.m04662 protein kinase family protein contains ... 27 9.5 At5g07150.1 68418.m00815 leucine-rich repeat family protein cont... 27 9.5 At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEME... 27 9.5 At3g19430.1 68416.m02464 late embryogenesis abundant protein-rel... 27 9.5 At1g75000.1 68414.m08707 GNS1/SUR4 membrane family protein conta... 27 9.5 >At2g33790.1 68415.m04144 pollen Ole e 1 allergen and extensin family protein similar to arabinogalactan protein [Daucus carota] GI:11322245, SP|Q03211 Pistil-specific extensin-like protein precursor (PELP) {Nicotiana tabacum}; contains Pfam profile PF01190: Pollen proteins Ole e I family Length = 239 Score = 31.9 bits (69), Expect = 0.33 Identities = 23/64 (35%), Positives = 32/64 (50%), Gaps = 4/64 (6%) Frame = -1 Query: 502 GNQDPVTKALPDSHPQPIRRAPTVP--AAPIPPQARPGQAQPLQAVLLPRAVQVHR--TL 335 G+ DP +LP P P + PT+P API A P P++ LP A + TL Sbjct: 31 GSSDPF-HSLPQHLPLPPIKLPTLPPAKAPIKLPAYPPAKAPIKLPTLPPAKAPIKLPTL 89 Query: 334 PPLR 323 PP++ Sbjct: 90 PPIK 93 >At1g26150.1 68414.m03192 protein kinase family protein similar to Pto kinase interactor 1 GI:3668069 from [Lycopersicon esculentum] Length = 760 Score = 31.1 bits (67), Expect = 0.58 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -1 Query: 499 NQDPVTKALPDSHPQPIRRAPTVPAAPIPPQARPGQAQPL-QAVLLPRAVQVHRTLPP 329 N P K +P SH P R P+ PA+ IPP R + P + P + H + PP Sbjct: 165 NPLPPPKLVPPSHSPP-RHLPSPPASEIPPPPRHLPSPPASERPSTPPSDSEHPSPPP 221 Score = 27.9 bits (59), Expect = 5.4 Identities = 22/65 (33%), Positives = 27/65 (41%), Gaps = 4/65 (6%) Frame = -1 Query: 493 DPVTKALPDSH---PQPIRRAPTVP-AAPIPPQARPGQAQPLQAVLLPRAVQVHRTLPPL 326 +PV+ P+S P P PT P +P PP P P LP LPP Sbjct: 113 NPVSSPPPESSPPPPPPTEAPPTTPITSPSPPTNPP--PPPESPPSLPAPDPPSNPLPPP 170 Query: 325 RLVFP 311 +LV P Sbjct: 171 KLVPP 175 >At1g13050.1 68414.m01513 expressed protein Length = 317 Score = 30.7 bits (66), Expect = 0.77 Identities = 14/32 (43%), Positives = 18/32 (56%) Frame = -1 Query: 472 PDSHPQPIRRAPTVPAAPIPPQARPGQAQPLQ 377 P S P P+R P P+PP+ P A+PLQ Sbjct: 68 PSSRPLPLR-----PEEPLPPRHNPNSARPLQ 94 >At3g11000.1 68416.m01328 expressed protein Length = 488 Score = 29.1 bits (62), Expect = 2.4 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -1 Query: 514 WWIEGNQDPVTKALPDSHPQPIRRAPTVPAAPIPPQARPGQAQPLQAV 371 +W E ++ K L P P R PT+ +PP +P A L + Sbjct: 124 FWFELDRGQTNKLLRLFKPSPSVRPPTISRDAVPPPRKPIPASSLAQI 171 >At2g21140.1 68415.m02508 hydroxyproline-rich glycoprotein family protein identical to proline-rich protein 2 [Arabidopsis thaliana] gi|7620011|gb|AAF64549 Length = 321 Score = 29.1 bits (62), Expect = 2.4 Identities = 16/46 (34%), Positives = 21/46 (45%), Gaps = 1/46 (2%) Frame = -1 Query: 460 PQPIRRAPTV-PAAPIPPQARPGQAQPLQAVLLPRAVQVHRTLPPL 326 P PI + P V P P PP+ +P + P V +T PPL Sbjct: 219 PVPIYKPPVVIPKKPCPPKIHKPIYKPPVPIYKPPVVIPKKTFPPL 264 >At2g14890.2 68415.m01692 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 176 Score = 29.1 bits (62), Expect = 2.4 Identities = 26/79 (32%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = -1 Query: 589 VIGVXFQVKRXPPKATPGSXEGGFWWWIEGNQDPVTKALP-DSHPQPIRRAPTVPAAPIP 413 + GV Q PP ATP PV+ P + P P+ AP PA P P Sbjct: 15 IAGVTGQAPTSPPTATPAPPTPTTPP-PAATPPPVSAPPPVTTSPPPVTTAPP-PANPPP 72 Query: 412 PQARPGQAQPLQAVLLPRA 356 P + P A P A P A Sbjct: 73 PVSSPPPASPPPATPPPVA 91 >At2g14890.1 68415.m01693 arabinogalactan-protein (AGP9) identical to gi|10880495|gb|AAG24277 Length = 191 Score = 29.1 bits (62), Expect = 2.4 Identities = 26/79 (32%), Positives = 31/79 (39%), Gaps = 1/79 (1%) Frame = -1 Query: 589 VIGVXFQVKRXPPKATPGSXEGGFWWWIEGNQDPVTKALP-DSHPQPIRRAPTVPAAPIP 413 + GV Q PP ATP PV+ P + P P+ AP PA P P Sbjct: 15 IAGVTGQAPTSPPTATPAPPTPTTPP-PAATPPPVSAPPPVTTSPPPVTTAPP-PANPPP 72 Query: 412 PQARPGQAQPLQAVLLPRA 356 P + P A P A P A Sbjct: 73 PVSSPPPASPPPATPPPVA 91 >At5g07760.1 68418.m00888 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 853 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/52 (34%), Positives = 22/52 (42%), Gaps = 1/52 (1%) Frame = -1 Query: 460 PQPIRRAPTVPAAPIPPQARPG-QAQPLQAVLLPRAVQVHRTLPPLRLVFPG 308 P P R +P P PP P A+ L P V+ LPP L+F G Sbjct: 58 PPPAMRRRVLPRPPPPPPPLPMFDAEVLCCCYPPTRVRREAPLPPPPLIFVG 109 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/48 (31%), Positives = 18/48 (37%) Frame = -1 Query: 472 PDSHPQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLPRAVQVHRTLPP 329 P P P+RR +P P PP R P + R V PP Sbjct: 27 PPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPPPPAMRRRVLPRPPPPP 74 >At4g00890.1 68417.m00120 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 431 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/57 (24%), Positives = 29/57 (50%), Gaps = 3/57 (5%) Frame = -1 Query: 496 QDPVTKALPDS---HPQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLPRAVQVHRTL 335 Q+ ++++ P S HPQ ++P +P+ P+++ L+ + V+ HR L Sbjct: 36 QETLSQSPPQSPLFHPQSPPEPKSLPLSPLSPKSKEEPESQTMTPLMSKHVKTHRNL 92 >At5g48360.1 68418.m05975 formin homology 2 domain-containing protein / FH2 domain-containing protein contains formin homology 2 domain, Pfam:PF02181 Length = 782 Score = 27.9 bits (59), Expect = 5.4 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 6/51 (11%) Frame = -1 Query: 454 PIRRAPTVPAAPIPPQAR------PGQAQPLQAVLLPRAVQVHRTLPPLRL 320 P+ +P P P+PP P + A++LPR+ + H T P L L Sbjct: 54 PLESSPPSPPPPLPPTPPTTFAVFPTFPANISALVLPRSSKPHHTSPTLLL 104 >At5g61090.1 68418.m07665 proline-rich family protein contains proline-rich extensin domains, INTERPRO:IPR002965; contains similarity to vegetative cell wall protein gp1 [Chlamydomonas reinhardtii] gi|12018147|gb|AAG45420; common family members: At4g18570, At3g25690, At4g04980 [Arabidopsis thaliana] Length = 344 Score = 27.5 bits (58), Expect = 7.2 Identities = 22/59 (37%), Positives = 26/59 (44%), Gaps = 5/59 (8%) Frame = -1 Query: 484 TKALPDSHPQ-PIRRAPT-VPAAPIPPQARPGQAQPLQAVLLP---RAVQVHRTLPPLR 323 T P S P PI P VPA P P RP A+P + P R + +TL P R Sbjct: 100 TPEAPRSVPACPIPEIPRPVPARPTPETPRPVTARPTPEIPRPVPARPISEVQTLVPTR 158 >At5g13480.1 68418.m01554 WD-40 repeat family protein similar to WD-repeat protein WDC146 (SP:Q9C0J8|) {Homo sapiens}; contains 3 weak Pfam PF00400: WD domain, G-beta repeats; Length = 711 Score = 27.5 bits (58), Expect = 7.2 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = -1 Query: 463 HPQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLPRAVQV--HRTLPP 329 HPQ + P +P +PP + PL LPR +Q+ H +PP Sbjct: 580 HPQQMLPMPNMPHHQLPPSSH----MPLHPHHLPRPMQMPPHGHMPP 622 >At2g35640.1 68415.m04371 hydroxyproline-rich glycoprotein family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 340 Score = 27.5 bits (58), Expect = 7.2 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = -1 Query: 499 NQDPVTKALPDSHPQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLPRAVQVHRTLP 332 +Q P T L P P + ++P+ P PP + A+P+ + + + RT P Sbjct: 185 HQIPTTIVLSLPPPPPQSLSLSLPSPPQPPPSSSFHAEPIPPTVGTSSTKRRRTTP 240 >At5g57625.1 68418.m07199 allergen V5/Tpx-1-related family protein low similarity to SP|Q40374 Pathogenesis-related protein PR-1 precursor {Medicago truncatula}; contains Pfam profile PF00188: SCP-like extracellular protein Length = 207 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 475 LPDSHPQPIRRAPTVPAAPIPPQAR 401 LP P+P+ R PT P+ P AR Sbjct: 49 LPSPSPKPVYRPPTTPSLPAGSIAR 73 >At5g38560.1 68418.m04662 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 681 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -1 Query: 460 PQPIRRAPTVPAAPIP--PQARPGQAQP 383 P P++ PT P+AP P P P Q+ P Sbjct: 22 PPPLQTQPTTPSAPPPVTPPPSPPQSPP 49 >At5g07150.1 68418.m00815 leucine-rich repeat family protein contains weak similarity to LRR receptor-like protein kinase [Nicotiana tabacum] gi|7672732|gb|AAF66615; contains Pfam PF00560 domain Leucine Rich Repeat Length = 553 Score = 27.1 bits (57), Expect = 9.5 Identities = 18/60 (30%), Positives = 25/60 (41%) Frame = -1 Query: 478 ALPDSHPQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLPRAVQVHRTLPPLRLVFPGVII 299 A P + Q I VP P P Q P Q P Q +P AV ++ + GV++ Sbjct: 181 ASPPTETQVIPNPSPVP--PPPAQPPPAQTPPPQLSEVPHAVNKKKSHKSKMYIIVGVLV 238 >At5g04560.1 68418.m00456 DEMETER protein (DME) identical to DEMETER protein [Arabidopsis thaliana] GI:21743571; contains Pfam profile PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 1729 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 460 PQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLP 362 P P R+ T P+PP++ P A P+ + LP Sbjct: 1402 PAPEERSLTSATIPVPPESYPPVAIPMIELPLP 1434 >At3g19430.1 68416.m02464 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 559 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 2/50 (4%) Frame = -1 Query: 505 EGNQDPVTKALPDSHPQPIRR--APTVPAAPIPPQARPGQAQPLQAVLLP 362 +G P P S P P +PT P +P PP P P V P Sbjct: 69 DGGYTPPAPVPPVSPPPPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 118 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -1 Query: 472 PDSHPQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLP 362 P P P +PT P +P PP P P V P Sbjct: 100 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 136 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -1 Query: 472 PDSHPQPIRRAPTVPAAPIPPQARPGQAQPLQAVLLP 362 P P P +PT P +P PP P P V P Sbjct: 118 PPPTPTPSVPSPTPPVSPPPPTPTPSVPSPTPPVSPP 154 >At1g75000.1 68414.m08707 GNS1/SUR4 membrane family protein contains Pfam profile PF01151: GNS1/SUR4 family Length = 281 Score = 27.1 bits (57), Expect = 9.5 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = -2 Query: 378 RQFFYLGRFKYIGRFLHFV*CFQESSFRREQTFTQAWSRKNSLC 247 R FF+ F Y+ RFLH F RR+ +F Q ++ + LC Sbjct: 125 RVFFWSYAF-YLSRFLHLFRTFFSVIRRRKLSFFQLINQSSLLC 167 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,962,869 Number of Sequences: 28952 Number of extensions: 245320 Number of successful extensions: 835 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 689 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 823 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -