BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0354.Seq (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_06_0729 - 26721730-26722797 28 6.5 06_03_1508 - 30653967-30654245,30654342-30654631,30654773-306548... 28 6.5 >11_06_0729 - 26721730-26722797 Length = 355 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +2 Query: 77 DRCDRETEESMQLIQNVTFHSAVFSSTVPYI 169 D CD+E E+ +QN+ F S SS P I Sbjct: 238 DGCDKEQEQDRPALQNLMFWSCKGSSDPPKI 268 >06_03_1508 - 30653967-30654245,30654342-30654631,30654773-30654841, 30654854-30654921,30655016-30655492,30655578-30655874, 30655974-30656824,30656917-30656990,30657270-30657292, 30657709-30657772,30658098-30658370,30658511-30658587, 30658686-30658912 Length = 1022 Score = 27.9 bits (59), Expect = 6.5 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 130 ISFRCIFFYCTVHFMKH 180 + FRC+ F+C V F KH Sbjct: 1006 VLFRCVAFFCMVIFQKH 1022 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,207,227 Number of Sequences: 37544 Number of extensions: 175975 Number of successful extensions: 271 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 271 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -