Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0354.Seq
         (598 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g61760.1 68416.m06927 dynamin-like protein B (DL1B) identical...    28   4.1  

>At3g61760.1 68416.m06927 dynamin-like protein B (DL1B) identical to
           dynamin-like protein B [Arabidopsis thaliana]
           GI:27543504; strong similarity to GTP-binding protein
           [Arabidopsis thaliana] GI:807577, phragmoplastin SDL5A
           [Glycine max] GI:1218004; contains Pfam profiles
           PF01031: Dynamin central region, PF00350: Dynamin
           family, PF02212: Dynamin GTPase effector domain
          Length = 610

 Score = 28.3 bits (60), Expect = 4.1
 Identities = 12/32 (37%), Positives = 18/32 (56%)
 Frame = +2

Query: 65  KKFPDRCDRETEESMQLIQNVTFHSAVFSSTV 160
           ++  D  DRET  S ++I  V  H ++FS  V
Sbjct: 104 QEISDETDRETGRSSKVISTVPIHLSIFSPNV 135


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,777,383
Number of Sequences: 28952
Number of extensions: 162501
Number of successful extensions: 309
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 304
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 309
length of database: 12,070,560
effective HSP length: 77
effective length of database: 9,841,256
effective search space used: 1190791976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)