BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0353.Seq (508 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 32 0.19 At4g04910.1 68417.m00714 AAA-type ATPase family protein similar ... 28 3.1 At4g38560.1 68417.m05459 expressed protein 28 4.2 At4g02180.1 68417.m00290 DC1 domain-containing protein contains ... 28 4.2 At5g12460.1 68418.m01464 fringe-related protein similarity to pr... 27 5.5 At1g14270.1 68414.m01692 CAAX amino terminal protease family pro... 27 7.3 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 32.3 bits (70), Expect = 0.19 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 260 LSDSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 159 +SDS S RPS+DWF N+S + + SS+ Sbjct: 221 VSDSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At4g04910.1 68417.m00714 AAA-type ATPase family protein similar to SP|P18708 Vesicular-fusion protein NSF (N-ethylmaleimide-sensitive fusion protein) (NEM-sensitive fusion protein) {Cricetulus griseus}; contains Pfam profiles PF00004: ATPase AAA family, PF02359: Cell division protein 48 (CDC48) N-terminal domain; contains non-consensus AT-AC splice sites at intron 2 Length = 742 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/29 (51%), Positives = 19/29 (65%), Gaps = 2/29 (6%) Frame = +1 Query: 199 DQNQSTEGLASE--VVNFDESDNFCRSHG 279 +Q+Q T G ASE V+ FDE D C+S G Sbjct: 307 EQDQRTLGDASELHVIIFDEIDAICKSRG 335 >At4g38560.1 68417.m05459 expressed protein Length = 521 Score = 27.9 bits (59), Expect = 4.2 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 6 SYMLVSKIKPCMSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILEL 149 SY + + + + + GD A+GS Q +SYS+ + V+LEL Sbjct: 341 SYKVRASVSSTLQKILDKHGDIASGSKLQSLRTKSYSLETLAAVVLEL 388 >At4g02180.1 68417.m00290 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 989 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = -2 Query: 474 VTTSTVPGVGNLRAXCLPW 418 V+ ++VPGVGN + LPW Sbjct: 330 VSRTSVPGVGNSKGVLLPW 348 >At5g12460.1 68418.m01464 fringe-related protein similarity to predicted proteins + similar to hypothetical protein GB:AAC23643 [Arabidopsis thaliana] + weak similarity to Fringe [Schistocerca gregaria](GI:6573138);Fringe encodes an extracellular protein that regulates Notch signalling. Length = 415 Score = 27.5 bits (58), Expect = 5.5 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -3 Query: 356 GNHGSRRNYHRKLIRQTFERCVAGT*PCDLQKLSDSSKL 240 GNH SR ++I T + V G CD+Q ++ + L Sbjct: 363 GNHSSRNITQVRVIATTMHKMVEGIECCDVQNVNSTEIL 401 >At1g14270.1 68414.m01692 CAAX amino terminal protease family protein contains Pfam profile PF02517: CAAX amino terminal protease family Length = 353 Score = 27.1 bits (57), Expect = 7.3 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 4 VVICLSQRLSHACLSASRIKAIPRMAQY 87 ++ CLSQ S CLS SR +P+ Y Sbjct: 18 IISCLSQSSSLLCLSDSRRLILPKTCTY 45 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,242,978 Number of Sequences: 28952 Number of extensions: 223596 Number of successful extensions: 532 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 522 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 532 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -