BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0350.Seq (648 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosacchar... 26 4.1 SPAC1805.16c |||purine nucleoside phosphorylase |Schizosaccharom... 26 5.4 SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces p... 25 7.1 >SPAC17G8.14c |pck1|SPAC22H10.01c|protein kinase C |Schizosaccharomyces pombe|chr 1|||Manual Length = 988 Score = 26.2 bits (55), Expect = 4.1 Identities = 11/53 (20%), Positives = 26/53 (49%) Frame = -3 Query: 514 IFNSIKSLRREKVKCFLPKMDIKTNIDMADLSQKMNVTKMFDPQSNDFEGILL 356 +FNS K L EK+ L + ++ +I+ +S + ++ + D +++ Sbjct: 105 LFNSEKPLSPEKISTMLQHLQMRLSIEQQCVSGIEKIMSLYSKEQKDKTDVII 157 >SPAC1805.16c |||purine nucleoside phosphorylase |Schizosaccharomyces pombe|chr 1|||Manual Length = 315 Score = 25.8 bits (54), Expect = 5.4 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +3 Query: 486 RLSDLMLLKIHLNFRNLA 539 ++ DLM+LK H+NF LA Sbjct: 144 KVGDLMILKDHINFPGLA 161 >SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces pombe|chr 1|||Manual Length = 1272 Score = 25.4 bits (53), Expect = 7.1 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -1 Query: 528 GNSDEFLIALNHLGERKSNVSYLRWI*KRTSIW 430 GNSD+ L++ +HLG+ + Y I K + W Sbjct: 195 GNSDDVLLSTDHLGKIAVHEFYNLVINKHCTSW 227 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,482,406 Number of Sequences: 5004 Number of extensions: 49192 Number of successful extensions: 131 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 129 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 131 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 291768710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -