BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0350.Seq (648 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g16800.1 68415.m01926 high-affinity nickel-transport family p... 28 4.7 At3g10650.1 68416.m01281 expressed protein 27 8.1 >At2g16800.1 68415.m01926 high-affinity nickel-transport family protein contains Pfam domain, PF03824: High-affinity nickel-transport protein Length = 372 Score = 28.3 bits (60), Expect = 4.7 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -1 Query: 555 PTPDVTPNYGNSDEFLIALNHLGERKSNVSYLRWI 451 P+PD +P S FLIA + K N +++ I Sbjct: 60 PSPDTSPGLNQSSNFLIASSQTDASKPNPGFIQRI 94 >At3g10650.1 68416.m01281 expressed protein Length = 1309 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 327 AAETYTGSEFNKIPSKSFDCGSNIL 401 +AE GS FN +P+KS + S IL Sbjct: 404 SAEDIPGSSFNLVPTKSSEMASKIL 428 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,553,715 Number of Sequences: 28952 Number of extensions: 242323 Number of successful extensions: 546 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 540 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1344285648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -