BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0348.Seq (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 23 2.3 DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate r... 22 5.3 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 5.3 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 6.9 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 21 6.9 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 21 9.2 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 21 9.2 AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase prec... 21 9.2 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 23.0 bits (47), Expect = 2.3 Identities = 5/6 (83%), Positives = 6/6 (100%) Frame = -1 Query: 271 RCCWHC 254 +CCWHC Sbjct: 604 QCCWHC 609 >DQ468657-1|ABE02558.1| 322|Apis mellifera 1,4,5-trisphosphate receptor protein. Length = 322 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = +2 Query: 197 GSGHKSATVQSSTTDKTSTAVPAAPIPP 280 G+ + A Q STTDK +A+ PP Sbjct: 223 GATPRKAPPQLSTTDKKGSAIDLDIGPP 250 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 5.3 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = +3 Query: 162 KTVSGGGIEGNQDPVT-KALPYSHPQPIRRAPQCQQHRFHLKHVRGKHN 305 + V GG + ++D T + P Q ++ Q QQ + L H HN Sbjct: 1427 REVHNGGQQEDRDRKTLTSAPQQPQQQQQQQQQQQQQQQQLNHYPDLHN 1475 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.4 bits (43), Expect = 6.9 Identities = 9/19 (47%), Positives = 9/19 (47%) Frame = +2 Query: 245 TSTAVPAAPIPPQARPGQA 301 TST A P PP G A Sbjct: 44 TSTTAAATPTPPSVPVGSA 62 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/22 (36%), Positives = 13/22 (59%), Gaps = 1/22 (4%) Frame = +2 Query: 173 WWWNRRKSG-SGHKSATVQSST 235 WWWN + S S K + ++ +T Sbjct: 366 WWWNMKISNLSFDKQSLLKENT 387 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 90 SVDVTLPSWLLELYP 46 S +TLPSW ++P Sbjct: 186 SYGLTLPSWTNNIFP 200 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 90 SVDVTLPSWLLELYP 46 S +TLPSW ++P Sbjct: 201 SYGLTLPSWTNNIFP 215 >AF205594-1|AAQ13840.1| 156|Apis mellifera acid phosphatase precursor protein. Length = 156 Score = 21.0 bits (42), Expect = 9.2 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 90 SVDVTLPSWLLELYP 46 S +TLPSW ++P Sbjct: 89 SYGLTLPSWTNNIFP 103 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 143,088 Number of Sequences: 438 Number of extensions: 3585 Number of successful extensions: 9 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -