BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0347.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) 74 1e-13 SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) 60 1e-09 SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) 55 5e-08 SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 7e-08 SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) 53 2e-07 SB_43842| Best HMM Match : RNB (HMM E-Value=0) 50 1e-06 SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) 47 1e-05 SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) 42 5e-04 SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.019 SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) 30 1.2 SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) 30 1.6 SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) 29 2.9 SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) 28 6.6 SB_12185| Best HMM Match : AAA_5 (HMM E-Value=0.002) 27 8.7 >SB_16431| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 790 Score = 73.7 bits (173), Expect = 1e-13 Identities = 32/91 (35%), Positives = 51/91 (56%) Frame = +1 Query: 259 QPFNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKT 438 +PFNKNFY+ HP + K+S E+++ R K + VSG P F F + + ++ Sbjct: 475 KPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDEQMMASIRK 534 Query: 439 MGYKEPTPIQAQGWPDSYVWKEFIGVXQTGS 531 + Y +PT IQ Q P + ++ IG+ +TGS Sbjct: 535 LEYTQPTQIQCQALPIALSGRDIIGIAKTGS 565 >SB_18993| Best HMM Match : DEAD (HMM E-Value=9.3e-41) Length = 690 Score = 60.5 bits (140), Expect = 1e-09 Identities = 27/56 (48%), Positives = 36/56 (64%) Frame = +1 Query: 307 RSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQ 474 R +EV+ YR ++TV+G V P+ FEE+ FPDY+Q K G+ EPT IQAQ Sbjct: 57 RGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQ 112 >SB_45898| Best HMM Match : DEAD (HMM E-Value=1.3e-36) Length = 428 Score = 54.8 bits (126), Expect = 5e-08 Identities = 25/67 (37%), Positives = 39/67 (58%) Frame = +1 Query: 331 YRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPDSYVWKEFI 510 +R ++ G + PI+ ++EA PD + + V +GYK+PTPIQ Q P ++ I Sbjct: 83 FREDFNISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDII 142 Query: 511 GVXQTGS 531 GV +TGS Sbjct: 143 GVAETGS 149 >SB_3952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 54.4 bits (125), Expect = 7e-08 Identities = 29/94 (30%), Positives = 48/94 (51%), Gaps = 1/94 (1%) Frame = +1 Query: 259 QPFNKNFYDPHPTVLKRSPYEVEEYRNKHE-VTVSGVEVHNPIQYFEEANFPDYVQQGVK 435 QPF K+FY P + K +P E +E+R E + V G P++ + + + +K Sbjct: 62 QPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLK 121 Query: 436 TMGYKEPTPIQAQGWPDSYVWKEFIGVXQTGSRQ 537 Y++PTPIQAQ P ++ I + T +R+ Sbjct: 122 KNSYEKPTPIQAQAIPVIMSGRDMIAIVMTPTRE 155 >SB_14524| Best HMM Match : DEAD (HMM E-Value=3.7e-17) Length = 500 Score = 52.8 bits (121), Expect = 2e-07 Identities = 26/84 (30%), Positives = 43/84 (51%) Frame = +1 Query: 280 YDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 459 Y HPT+ + +V++ R+K E+ V G V +P+ F +F + + + + GY PT Sbjct: 161 YKEHPTIAALTAEQVKQLRDKMEIKVKGEHVVSPVLEFFHCSFNESLSKNLSNHGYHSPT 220 Query: 460 PIQAQGWPDSYVWKEFIGVXQTGS 531 PIQ Q P ++ + TGS Sbjct: 221 PIQMQVLPVLLSGRDVMVCASTGS 244 >SB_43842| Best HMM Match : RNB (HMM E-Value=0) Length = 1238 Score = 50.0 bits (114), Expect = 1e-06 Identities = 26/89 (29%), Positives = 45/89 (50%) Frame = +1 Query: 265 FNKNFYDPHPTVLKRSPYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 444 F ++YD + V + S V+E R K+ + + G + PI+ F + N P + + Sbjct: 32 FMWSYYDENEKVSRLSDEVVDEIRWKNGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKN 91 Query: 445 YKEPTPIQAQGWPDSYVWKEFIGVXQTGS 531 ++ PTPIQ Q ++ IG+ +TGS Sbjct: 92 FQVPTPIQMQSLSCVMSGRDIIGLAETGS 120 >SB_46680| Best HMM Match : Helicase_C (HMM E-Value=3.8e-22) Length = 1058 Score = 46.8 bits (106), Expect = 1e-05 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 4/59 (6%) Frame = +1 Query: 319 EVEEYRNKHEVTVSGVEVHNPIQYF----EEANFPDYVQQGVKTMGYKEPTPIQAQGWP 483 ++ +R++ + V G +V +P++ F E FPDY+ V+ GY PTPIQ Q P Sbjct: 137 KINLFRHEQHIYVKGADVPDPVETFSQLIERYGFPDYIIHNVQERGYTTPTPIQMQATP 195 >SB_25090| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1170 Score = 41.5 bits (93), Expect = 5e-04 Identities = 25/69 (36%), Positives = 35/69 (50%) Frame = +1 Query: 325 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPDSYVWKE 504 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q P ++ Sbjct: 692 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 750 Query: 505 FIGVXQTGS 531 + QTGS Sbjct: 751 VMACAQTGS 759 >SB_5994| Best HMM Match : zf-CCHC (HMM E-Value=2.2e-19) Length = 185 Score = 41.5 bits (93), Expect = 5e-04 Identities = 25/69 (36%), Positives = 35/69 (50%) Frame = +1 Query: 325 EEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPDSYVWKE 504 E+Y ++ EV VSG I FEEAN + V+ YK+PTP+Q P ++ Sbjct: 115 EKY-DQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRD 173 Query: 505 FIGVXQTGS 531 + QTGS Sbjct: 174 VMACAQTGS 182 >SB_19958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 797 Score = 36.3 bits (80), Expect = 0.019 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = +1 Query: 355 VSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPDSYVWKEFIGVXQTGS 531 VSG I F E F + + + GY+ PTP+Q P ++ + QTGS Sbjct: 469 VSGENQPPKITSFNELPFGEQLMANISRAGYRRPTPVQKAALPIVMAGRDLMACAQTGS 527 >SB_30826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1375 Score = 32.7 bits (71), Expect = 0.23 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +1 Query: 382 IQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWPDSYVWKEFIGVXQTGS 531 I FE+ + + + V GYK+PTP+Q P ++ + QTGS Sbjct: 874 ILQFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGS 923 >SB_49218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 480 Score = 30.7 bits (66), Expect = 0.93 Identities = 11/38 (28%), Positives = 17/38 (44%) Frame = +1 Query: 367 EVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQAQGW 480 ++H P++ + FP Y + Y P P QA W Sbjct: 6 DIHGPVRKLHKHGFPGYEEDYAAVFKYPTPWPEQAMEW 43 >SB_52637| Best HMM Match : Cpn60_TCP1 (HMM E-Value=0) Length = 505 Score = 30.3 bits (65), Expect = 1.2 Identities = 14/44 (31%), Positives = 26/44 (59%) Frame = +1 Query: 313 PYEVEEYRNKHEVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMG 444 P+E + + KH++ V+ VE + +Q +E F + ++Q VK G Sbjct: 252 PFEPPKPKTKHKLDVATVEDYKKLQEYEREKFTEMIKQ-VKDTG 294 >SB_57459| Best HMM Match : DEAD (HMM E-Value=1.50001e-40) Length = 490 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +1 Query: 340 KHEVTVSGVEVHNPI---QYFEEANFPDYVQQGVKTMGYKEPTPIQAQGWP 483 KHEV V + +P+ + FEE +++GV MG+ +P+ IQ P Sbjct: 85 KHEVEVLRSDPSSPLYSAKSFEELPLSANLRRGVYDMGFNKPSKIQETALP 135 >SB_18655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 697 Score = 29.9 bits (64), Expect = 1.6 Identities = 14/42 (33%), Positives = 26/42 (61%), Gaps = 1/42 (2%) Frame = +1 Query: 409 PDYVQQGVKTMGYKEPTPIQAQGWPDSYVW-KEFIGVXQTGS 531 PD + + + G+ +PTPIQ+ P + ++ ++ IG +TGS Sbjct: 139 PD-ILRALGDQGFSKPTPIQSLSIPPALLYHRDIIGAAETGS 179 >SB_3046| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 734 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 197 HQSLQILQIYCHRCQTETNYRRICCLLQIWNHRFHGY 87 H L YC RC T CCLLQ++++ ++G+ Sbjct: 484 HLQQPSLAAYC-RCITILTTAIACCLLQVYHNTYNGH 519 >SB_6554| Best HMM Match : Isy1 (HMM E-Value=0) Length = 675 Score = 29.1 bits (62), Expect = 2.9 Identities = 13/32 (40%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = +1 Query: 325 EEYRNK-HEVTVSGVEVHNPIQYFEEANFPDY 417 EE NK H++ + + +HNP YFE+ + DY Sbjct: 234 EEVNNKLHKILIVNM-IHNPFNYFEKKSPTDY 264 >SB_23248| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 29 Score = 28.7 bits (61), Expect = 3.8 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = -1 Query: 262 VGVNRIPIWASHVLPSREF 206 VGV I WAS++LPSR+F Sbjct: 10 VGVRDIEQWASNLLPSRQF 28 >SB_8125| Best HMM Match : MFS_1 (HMM E-Value=3.2e-07) Length = 401 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 1/49 (2%) Frame = -3 Query: 221 ALQRILFSHQSLQILQIYCHRCQTETNYRRICCLLQIWN-HRFHGYYSS 78 AL+RI + ++ C +YRR CC L +W H + Y+SS Sbjct: 197 ALERIATPVTTSKLRCSTTQECCVRVDYRRKCC-LHVWRVHTTNTYWSS 244 >SB_12185| Best HMM Match : AAA_5 (HMM E-Value=0.002) Length = 3616 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +2 Query: 221 QNMRRPDWDSVYSNLSTKTFMIHILQFSKDHHMKSKSIEI 340 +NM +P W +S F+ ++L F KD + +++E+ Sbjct: 3073 RNMLKPSWSESLKLMSKSDFLNNLLNFDKD-SINDETVEL 3111 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,086,748 Number of Sequences: 59808 Number of extensions: 348132 Number of successful extensions: 945 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 889 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 944 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -