BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0346.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) 30 1.2 SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 >SB_55145| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 625 Score = 30.3 bits (65), Expect = 1.2 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = -1 Query: 184 DMGSEHYCLRWNNHQSNLLGVFSQLLHDESLVDVTLACAEGASIRAHKVI 35 D+ + + N+ S + +QLL E L DVT+ E IR H+V+ Sbjct: 3 DILIQEFTYEANDLPSQAFTILTQLLEQEKLCDVTIKAGE-RKIRCHRVV 51 >SB_54885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2988 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/63 (26%), Positives = 29/63 (46%) Frame = -3 Query: 569 RCSXGKYXHFXPPXPYSNGYISXKTSISCPKXGGIYV*DLWFPVIIK*VVYSLISPFYVF 390 R + G + F PYSN + + + GG +V +F + YSL+ F++F Sbjct: 2535 RYTAGLFTEFTLYNPYSNLFTASTVLVEVLPTGGFHVRPEFFTFRL----YSLVGDFHIF 2590 Query: 389 VIV 381 +V Sbjct: 2591 TLV 2593 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,827,674 Number of Sequences: 59808 Number of extensions: 312603 Number of successful extensions: 562 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 530 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 562 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -