BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0346.Seq (598 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC059404-1|AAH59404.1| 480|Homo sapiens B-cell CLL/lymphoma 6, ... 30 5.4 AB076581-1|BAC00963.1| 480|Homo sapiens BAZF protein. 30 5.4 AB076580-1|BAC00962.1| 480|Homo sapiens BAZF protein. 30 5.4 >BC059404-1|AAH59404.1| 480|Homo sapiens B-cell CLL/lymphoma 6, member B (zinc finger protein) protein. Length = 480 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -1 Query: 178 GSEHYCLRWNNHQSNLLGVFSQLLHDESLVDVTLACAEGASIRAHKVI 35 G+ Y + H S++LG ++L L DVTL G +RAHK + Sbjct: 9 GALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVG-GQPLRAHKAV 55 >AB076581-1|BAC00963.1| 480|Homo sapiens BAZF protein. Length = 480 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -1 Query: 178 GSEHYCLRWNNHQSNLLGVFSQLLHDESLVDVTLACAEGASIRAHKVI 35 G+ Y + H S++LG ++L L DVTL G +RAHK + Sbjct: 9 GALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVG-GQPLRAHKAV 55 >AB076580-1|BAC00962.1| 480|Homo sapiens BAZF protein. Length = 480 Score = 30.3 bits (65), Expect = 5.4 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = -1 Query: 178 GSEHYCLRWNNHQSNLLGVFSQLLHDESLVDVTLACAEGASIRAHKVI 35 G+ Y + H S++LG ++L L DVTL G +RAHK + Sbjct: 9 GALGYVREFTRHSSDVLGNLNELRLRGILTDVTLLVG-GQPLRAHKAV 55 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 78,464,077 Number of Sequences: 237096 Number of extensions: 1436854 Number of successful extensions: 2193 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2193 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 6324506272 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -