BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0345.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) 157 6e-39 SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) 147 5e-36 SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) 133 9e-32 SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) 119 2e-27 SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) 71 9e-13 SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.043 SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.40 SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) 31 0.71 SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) 31 0.71 SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) 31 0.71 SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) 31 0.71 SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.93 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) 30 1.2 SB_35674| Best HMM Match : SH2 (HMM E-Value=0) 30 1.2 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 30 1.6 SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) 30 1.6 SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) 30 1.6 SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) 30 1.6 SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) 30 1.6 SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) 30 1.6 SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) 29 2.2 SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8 SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) 29 3.8 SB_49603| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_44922| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=0) 28 5.0 SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) 28 5.0 SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) 28 5.0 SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_24447| Best HMM Match : TolA (HMM E-Value=1.3) 28 5.0 SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) 28 5.0 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 28 5.0 SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) 28 6.6 SB_40334| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) 28 6.6 SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) 28 6.6 SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_28185| Best HMM Match : FIVAR (HMM E-Value=2.2) 27 8.7 SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) 27 8.7 SB_51415| Best HMM Match : zf-CCCH (HMM E-Value=1.1) 27 8.7 SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) 27 8.7 SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) 27 8.7 SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_8472| Best HMM Match : TatC (HMM E-Value=1.4) 27 8.7 SB_3240| Best HMM Match : Sec8_exocyst (HMM E-Value=0.48) 27 8.7 >SB_45540| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1097 Score = 157 bits (381), Expect = 6e-39 Identities = 77/113 (68%), Positives = 91/113 (80%) Frame = -3 Query: 590 GKFXX*PGIPPAPRGVPQI*GHLXHRCXGILNVSAIXKSTNKEXKITITNDKGRLSKEEI 411 GKF GIPPAPRGVPQI GILNVSA+ KST KE KITITNDKGRLSKE+I Sbjct: 459 GKFEL-TGIPPAPRGVPQIEVTFDIDANGILNVSAVDKSTGKENKITITNDKGRLSKEDI 517 Query: 410 ERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDKR 252 ERMVNEA KY+ ED+KQ++ IQ KN+LESY +SMKST+ED+K+K+KIS+ DK+ Sbjct: 518 ERMVNEASKYKEEDEKQRDRIQTKNSLESYAYSMKSTVEDDKVKDKISEEDKK 570 Score = 70.9 bits (166), Expect = 7e-13 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -2 Query: 258 QETILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 121 ++ ILDKC + +KWLD+NQ A+K+E+E+ QKELE + NPIITK+YQ Sbjct: 569 KKAILDKCTEVLKWLDTNQTAEKDEFEYHQKELEKVCNPIITKLYQ 614 >SB_56180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 746 Score = 147 bits (357), Expect = 5e-36 Identities = 74/112 (66%), Positives = 88/112 (78%) Frame = -3 Query: 590 GKFXX*PGIPPAPRGVPQI*GHLXHRCXGILNVSAIXKSTNKEXKITITNDKGRLSKEEI 411 GKF GIPPAPRGVPQI GILNVSA+ KST KE KITITNDKGRLSKE+I Sbjct: 551 GKFEL-SGIPPAPRGVPQIDVTFDVDSNGILNVSAVDKSTGKENKITITNDKGRLSKEDI 609 Query: 410 ERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 255 ERMV EAEK++ D+ +E IQ+KN+LESY FSMKSTMEDEK+K+K+S+ ++ Sbjct: 610 ERMVKEAEKFKAADEAVRERIQSKNSLESYAFSMKSTMEDEKVKDKLSEDER 661 Score = 62.5 bits (145), Expect = 3e-10 Identities = 25/46 (54%), Positives = 35/46 (76%) Frame = -2 Query: 258 QETILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMYQ 121 +E ++ +C T+ WL+ NQ A+KEE + QKELEG+ NPIITK+YQ Sbjct: 661 REKVISRCKATLDWLEHNQSAEKEEIDAHQKELEGVCNPIITKLYQ 706 >SB_8490| Best HMM Match : HSP70 (HMM E-Value=0) Length = 640 Score = 133 bits (322), Expect = 9e-32 Identities = 68/112 (60%), Positives = 81/112 (72%) Frame = -3 Query: 590 GKFXX*PGIPPAPRGVPQI*GHLXHRCXGILNVSAIXKSTNKEXKITITNDKGRLSKEEI 411 GKF GIPPAPRGVPQI GILNVSA KST K ITITNDKGRLSKEEI Sbjct: 458 GKFDL-SGIPPAPRGVPQIEVTFDIDANGILNVSAKDKSTGKTGSITITNDKGRLSKEEI 516 Query: 410 ERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 255 +RM+N+AEKY++ED+ Q+E I A+N LESY F +KS + + L+ K+S SDK Sbjct: 517 DRMINDAEKYKSEDEAQREKIAARNRLESYAFGVKSAISEPSLEGKLSQSDK 568 Score = 49.6 bits (113), Expect = 2e-06 Identities = 17/45 (37%), Positives = 34/45 (75%) Frame = -2 Query: 258 QETILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNPIITKMY 124 ++T+ +K + + WL+ N LA+KEE+E ++KEL+ + +PI+ K++ Sbjct: 568 KDTVKNKVEEVLNWLEKNSLAEKEEFEEQEKELQRVCSPIMAKVH 612 >SB_45647| Best HMM Match : HSP70 (HMM E-Value=0) Length = 1327 Score = 119 bits (286), Expect = 2e-27 Identities = 63/114 (55%), Positives = 80/114 (70%), Gaps = 1/114 (0%) Frame = -3 Query: 590 GKFXX*PGIPPAPRGVPQI*GHLXHRCXGILNVSAIXKSTNKEXKITITNDKGRLSKEEI 411 GKF GIPPAPRGVPQI GIL VSA K T + KITITND+ RL+ E+I Sbjct: 1152 GKFDL-NGIPPAPRGVPQIEVTFEIDVNGILRVSAEDKGTGNKEKITITNDQNRLTPEDI 1210 Query: 410 ERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKR 252 ERMVN+AEK+ +ED K KE ++A+N LESY +S+K+ + D EKL K+S+ DK+ Sbjct: 1211 ERMVNDAEKFADEDKKTKEKVEARNELESYAYSLKNQVGDKEKLGGKLSEDDKK 1264 Score = 31.9 bits (69), Expect = 0.40 Identities = 11/39 (28%), Positives = 25/39 (64%) Frame = -2 Query: 258 QETILDKCNDTIKWLDSNQLADKEEYEHKQKELEGIYNP 142 ++TI + I W+D NQ A E+++ ++++ + +Y+P Sbjct: 1263 KKTITEAVEKAISWMDKNQDASVEDFKKEKRKWKMLYSP 1301 >SB_38725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 70.5 bits (165), Expect = 9e-13 Identities = 40/80 (50%), Positives = 50/80 (62%) Frame = -3 Query: 569 GIPPAPRGVPQI*GHLXHRCXGILNVSAIXKSTNKEXKITITNDKGRLSKEEIERMVNEA 390 GIPPAPRGVPQ+ GI+NVSA K T +E +I I + G LSK+ IE M+ EA Sbjct: 269 GIPPAPRGVPQVEVTFDIDANGIVNVSARDKGTGREQQIVIQSSGG-LSKDAIENMIKEA 327 Query: 389 EKYRNEDDKQKETIQAKNAL 330 EKY E DKQK+ + K + Sbjct: 328 EKYA-EADKQKKVEKLKEEI 346 >SB_31398| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1019 Score = 35.1 bits (77), Expect = 0.043 Identities = 26/107 (24%), Positives = 44/107 (41%), Gaps = 1/107 (0%) Frame = -3 Query: 479 KSTNKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKST 300 K E K ++ K++ + E + DD + +AKNALES+ F ++ Sbjct: 674 KKEGDESKSEGKKEEPTADKDKKAEKADGKEAPKARDDAKAANERAKNALESHIFGVRDE 733 Query: 299 MEDEKLKEKISDSDKRXXXXXXXXXXSGWI-PTSWPTRRSMSTSRKN 162 M E L EK+S +R S W+ W + ++ + N Sbjct: 734 MNSE-LGEKLSTEAERETISEALTAASDWLDEDGWDSTANVYNEKLN 779 >SB_2840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2248 Score = 31.9 bits (69), Expect = 0.40 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%) Frame = -3 Query: 479 KSTNKEXKITITNDKGRLSKEEIER--MVNEAEKYRNEDDKQKETIQAKNA 333 K+T+K + ITN G++ KEE +R V E++K K++E I+ K A Sbjct: 1135 KATSKLQEEEITNAMGKIEKEEAKRKAAVEESQKAIEAARKKQEEIRQKQA 1185 >SB_17273| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 58 Score = 31.1 bits (67), Expect = 0.71 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 237 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 127 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 7 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 44 >SB_6748| Best HMM Match : Pkinase (HMM E-Value=1.7e-05) Length = 315 Score = 31.1 bits (67), Expect = 0.71 Identities = 20/75 (26%), Positives = 40/75 (53%) Frame = -3 Query: 491 SAIXKSTNKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFS 312 S++ S NK+ K+ K ++ K+++++ E ++ DDK KET+ N +ES Sbjct: 212 SSMKLSKNKKKKMK-KKLKKQIEKQKLQQDEIEQGLLQDSDDKDKETL-GDNCIESNDME 269 Query: 311 MKSTMEDEKLKEKIS 267 + E++ E++S Sbjct: 270 ESAKDSSEEISEELS 284 >SB_57319| Best HMM Match : Pox_A_type_inc (HMM E-Value=6.3e-06) Length = 348 Score = 31.1 bits (67), Expect = 0.71 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -3 Query: 458 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 285 ++T D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 126 QLTSKADYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_40385| Best HMM Match : Kelch_1 (HMM E-Value=0) Length = 823 Score = 31.1 bits (67), Expect = 0.71 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%) Frame = -2 Query: 237 CNDTIKWLDSN-QLADKEEYEHKQKELEGIYNPIITKM 127 C++ +WL++N A EE ++++L G+ PI++K+ Sbjct: 772 CDEKSEWLENNADTASLEEIVKQKEDLAGVLQPILSKL 809 >SB_15994| Best HMM Match : Pox_A_type_inc (HMM E-Value=2e-06) Length = 364 Score = 31.1 bits (67), Expect = 0.71 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -3 Query: 458 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKN-ALESYCFSMKSTMEDEK 285 ++T D G + EE++R+ NE EK +NE + K+ L++Y + E EK Sbjct: 126 QLTSKADYGNIHAEELQRIRNELEKCKNEISDLNSKLNTKSQKLKTYKKHIGELQEREK 184 >SB_45987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1339 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/62 (24%), Positives = 34/62 (54%) Frame = -3 Query: 458 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 279 K+ I +D G L ++ N+ +K + E+D+ +E + E++ SM+ + D++ + Sbjct: 975 KVKIYDDDGDLKVSKLTGFFNDDDKEKEEEDRAEECEET----EAHIISMQEEVNDDETE 1030 Query: 278 EK 273 E+ Sbjct: 1031 EE 1032 >SB_28981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 30.7 bits (66), Expect = 0.93 Identities = 15/41 (36%), Positives = 26/41 (63%) Frame = -3 Query: 449 ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALE 327 + +K RL EE+ER+ E +K E+ K++ET++ K L+ Sbjct: 277 LEEEKKRL--EELERLKEEKDKMLEEELKKRETLEEKQKLQ 315 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 30.3 bits (65), Expect = 1.2 Identities = 20/72 (27%), Positives = 33/72 (45%) Frame = -3 Query: 467 KEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDE 288 KE K ++ +EE ER E K E+ KQ+E + K E + E+E Sbjct: 433 KERKKREAEEEEERRREEEERREEEERKREEEERKQREEEEKKREEEE-----RKQREEE 487 Query: 287 KLKEKISDSDKR 252 + K+K + +K+ Sbjct: 488 ERKQKEKEEEKK 499 >SB_2026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1789 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = -3 Query: 479 KSTNKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFS 312 K +++ K DKG K++ E ++ E +++ + +KE Q+ K ES C S Sbjct: 1513 KGESEKDKGESEKDKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCES 1572 Query: 311 MKSTMEDEKLKEKISDSD 258 K E EK E+ D + Sbjct: 1573 EKEKCESEKKVEESKDEN 1590 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/73 (23%), Positives = 35/73 (47%) Frame = -3 Query: 479 KSTNKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKST 300 K +++ K DKG KE+ + + E + + + +KE +++ +E K Sbjct: 1534 KGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVE----ESKDE 1589 Query: 299 MEDEKLKEKISDS 261 +EK++EK D+ Sbjct: 1590 NPEEKIEEKKDDT 1602 >SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) Length = 381 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -2 Query: 531 RSPXTSMPRYPQRFRYRXVHQQGXQDHHYQRQRSSLQGRDR 409 R P PR +R RYR + + +D + R R + R R Sbjct: 275 RDPDRDRPRDSERDRYRDIERDRHRDRRHSRDRDRKRSRSR 315 >SB_35674| Best HMM Match : SH2 (HMM E-Value=0) Length = 871 Score = 30.3 bits (65), Expect = 1.2 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 4/78 (5%) Frame = -3 Query: 479 KSTNKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQA-KNALES---YCFS 312 K +++ K DKG K++ E ++ E +++ + +KE Q+ K ES C S Sbjct: 92 KGESEKDKGESEKDKGESEKDKGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCES 151 Query: 311 MKSTMEDEKLKEKISDSD 258 K E EK E+ D + Sbjct: 152 EKEKCESEKKVEESKDEN 169 Score = 29.1 bits (62), Expect = 2.9 Identities = 17/73 (23%), Positives = 35/73 (47%) Frame = -3 Query: 479 KSTNKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKST 300 K +++ K DKG KE+ + + E + + + +KE +++ +E K Sbjct: 113 KGESEKDKGESEKDKGESEKEKCQSEKEKCESEKEKCESEKEKCESEKKVE----ESKDE 168 Query: 299 MEDEKLKEKISDS 261 +EK++EK D+ Sbjct: 169 NPEEKIEEKKDDT 181 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 29.9 bits (64), Expect = 1.6 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = -3 Query: 479 KSTNKEXKITITNDKGRLSKEEIERMVNEAE-KYRNEDDKQKETIQAKNALESYCFSMKS 303 K+ + KI + N+ + SKE++ER V AE + R+ D + K +++LE S Sbjct: 1032 KTRRQLNKILVENENLKGSKEDLERRVVVAENRLRDTDSEMKGWRDIRSSLERDLQSRDH 1091 Query: 302 TMED 291 +++D Sbjct: 1092 SIDD 1095 >SB_39770| Best HMM Match : TolA (HMM E-Value=0.33) Length = 732 Score = 29.9 bits (64), Expect = 1.6 Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 2/84 (2%) Frame = -3 Query: 500 LNVSAIXKSTNKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDK--QKETIQAKNALE 327 L SA+ TNK+ + + R+ E ER+ E K E K QKE AK LE Sbjct: 176 LRRSAMDAGTNKKVEEEERLTRARIQAEAAERLAKEVTKTLEELRKTMQKELEDAKVKLE 235 Query: 326 SYCFSMKSTMEDEKLKEKISDSDK 255 +++ KE+ S+ ++ Sbjct: 236 QEKKDSVKKLKERLEKERESEEER 259 >SB_23940| Best HMM Match : MuDR (HMM E-Value=0.24) Length = 685 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/62 (24%), Positives = 33/62 (53%) Frame = -3 Query: 458 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 279 K+ I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ + Sbjct: 448 KVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETE 503 Query: 278 EK 273 E+ Sbjct: 504 EE 505 >SB_54309| Best HMM Match : SH2 (HMM E-Value=5.1e-17) Length = 1249 Score = 29.9 bits (64), Expect = 1.6 Identities = 18/62 (29%), Positives = 35/62 (56%) Frame = -3 Query: 440 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 261 ++ + KEE ER+ EAE+ R ED++Q+ + + A E +K M+ K + + ++ Sbjct: 411 EEEKRQKEEEERLRVEAERQREEDERQRAEDERQRA-EDERQRVKHEMQRLKDERRRAEE 469 Query: 260 DK 255 D+ Sbjct: 470 DE 471 Score = 29.9 bits (64), Expect = 1.6 Identities = 35/144 (24%), Positives = 54/144 (37%), Gaps = 4/144 (2%) Frame = -3 Query: 422 KEEIERMVNEAEKYRNEDDKQKET-IQAKNALESYCFSMKSTMEDEKLKEKISDSDKRXX 246 K + E+ E E E ++ +E I K E K E KL+E S+K+ Sbjct: 596 KRKEEKAQRERELIEQEKNRAREIYISLKRVREQV--KQKEAEEQRKLEEAWQRSEKKAK 653 Query: 245 XXXXXXXXSGWIPTSWPTR-RSMSTSRKNW--KAFTIR*LRRCTRVPEESPEVCRASRAE 75 S I S R R+++ R+N + I ++P + V + SRA Sbjct: 654 EAERDRRNSVSIARSEVLRERALAAKRRNTMGQKIVIEAPHTPPQIPTRTGSVNKPSRAP 713 Query: 74 HPEPEVPPPGLEALAPPSRRSIKP 3 P P P P + +S P Sbjct: 714 PPVPNHPSPAVPLRREGDTKSFAP 737 Score = 27.5 bits (58), Expect = 8.7 Identities = 17/68 (25%), Positives = 37/68 (54%), Gaps = 3/68 (4%) Frame = -3 Query: 446 TNDKGRLSKEE---IERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 276 T ++ R ++EE I R EAE+ R E +++++ + +ALE C + + ++K Sbjct: 508 TEERERQAREEEDRIRREREEAERLRREKEQREQLVPHSDALE--CAIKPLNLLEARIKA 565 Query: 275 KISDSDKR 252 + + ++R Sbjct: 566 QKLEEEQR 573 >SB_52390| Best HMM Match : Cauli_DNA-bind (HMM E-Value=6.4) Length = 232 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/62 (24%), Positives = 33/62 (53%) Frame = -3 Query: 458 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 279 K+ I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ + Sbjct: 87 KVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETE 142 Query: 278 EK 273 E+ Sbjct: 143 EE 144 >SB_42837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.6 Identities = 16/53 (30%), Positives = 31/53 (58%) Frame = -3 Query: 479 KSTNKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY 321 ++ N+E KI T +K + +E+IE E + NE+++++ET + + E Y Sbjct: 71 EAENEEEKIEET-EKEKDEEEKIEEEEKEGGEEENEEEEEEETEEEEEKEEEY 122 >SB_23775| Best HMM Match : Tropomyosin (HMM E-Value=0) Length = 442 Score = 29.9 bits (64), Expect = 1.6 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 2/73 (2%) Frame = -3 Query: 485 IXKSTNKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQK--ETIQAKNALESYCFS 312 + K KE K +K RL K++ E +K + E++K+K E I AK + Sbjct: 355 LEKQAEKEKK-----EKERLEKKQREEKDRLEKKEKKEEEKRKKEEEINAKIEEKKKREE 409 Query: 311 MKSTMEDEKLKEK 273 K E+EK+K+K Sbjct: 410 KKKQEEEEKMKKK 422 Score = 28.7 bits (61), Expect = 3.8 Identities = 17/50 (34%), Positives = 27/50 (54%) Frame = -3 Query: 422 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 273 K+E ER+ +AEK + K+KE ++ K E K E+EK K++ Sbjct: 349 KKEQERLEKQAEK----EKKEKERLEKKQREEKDRLEKKEKKEEEKRKKE 394 >SB_3809| Best HMM Match : DUF1014 (HMM E-Value=8.7e-09) Length = 265 Score = 29.5 bits (63), Expect = 2.2 Identities = 16/63 (25%), Positives = 33/63 (52%) Frame = -3 Query: 440 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 261 +K R +EE +++ + +K+ ++ K+ E ++ KNA E++ LK K S+S Sbjct: 50 EKERKEREEEDKLWEDDDKHEQQEKKRLEALERKNAARQML-----EEEEKSLKGKTSNS 104 Query: 260 DKR 252 + Sbjct: 105 SAK 107 >SB_10624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2193 Score = 29.5 bits (63), Expect = 2.2 Identities = 20/60 (33%), Positives = 30/60 (50%) Frame = -3 Query: 440 DKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDS 261 DK +L KEE E+ + E NE KQKE +A++ L++ + D K E D+ Sbjct: 1606 DKYQLEKEEAEKRLQSYEDELNEKQKQKE--KAEDNLKALKKRISDLEVDNKNLETARDN 1663 >SB_59386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1037 Score = 29.1 bits (62), Expect = 2.9 Identities = 15/41 (36%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -3 Query: 446 TNDKGRLSKEEIERMVNEAEKY-RNEDDKQKETIQAKNALE 327 TND G S +E E VN ++K NE++ + E ++ +N++E Sbjct: 888 TNDNGS-STDEAESEVNNSDKEGENEENDEVEDMEVENSIE 927 >SB_22350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1967 Score = 28.7 bits (61), Expect = 3.8 Identities = 18/51 (35%), Positives = 28/51 (54%) Frame = -3 Query: 428 LSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 276 L ++ +VNE +K + + D QK+ I+ + ES + ME EKLKE Sbjct: 1182 LKAARLKELVNELDKMKKDLDAQKQAIEESRSEES---GIIGEME-EKLKE 1228 >SB_46225| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00052) Length = 649 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/41 (39%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -3 Query: 422 KEEIERMVNEAEKYRNEDDK-QKETIQAKNALESYCFSMKS 303 KE+I+ NEA++ + DK +KE +KN LES +K+ Sbjct: 2 KEDIQVRSNEAQREARKKDKLEKELKTSKNDLESKTAELKT 42 >SB_49603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 470 NKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 363 NKE K + DKG K ++E EKY E+DK Sbjct: 72 NKE-KYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 106 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 470 NKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 363 NKE K + DKG K ++E EKY E+DK Sbjct: 84 NKE-KYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 118 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 470 NKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 363 NKE K + DKG K ++E EKY E+DK Sbjct: 96 NKE-KYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 130 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 470 NKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 363 NKE K + DKG K ++E EKY E+DK Sbjct: 108 NKE-KYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 142 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 470 NKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 363 NKE K + DKG K ++E EKY E+DK Sbjct: 120 NKE-KYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 154 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 470 NKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDK 363 NKE K + DKG K ++E EKY E+DK Sbjct: 132 NKE-KYDLEEDKGNKEKYDLEEDKGNKEKYDLEEDK 166 >SB_44922| Best HMM Match : RNA_pol_Rpb1_1 (HMM E-Value=0) Length = 1596 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/74 (20%), Positives = 40/74 (54%), Gaps = 1/74 (1%) Frame = -3 Query: 470 NKEXKITITNDKGRLSKEEIERMVNEAE-KYRNEDDKQKETIQAKNALESYCFSMKSTME 294 +K + + N+ L E +E +++ + + NE+++++E + +++ S + E Sbjct: 329 SKAGNMAVGNENETLDHEIVEETMSDPDPEEENEEEEEEEEEDLVDPMDAIRESCEEKPE 388 Query: 293 DEKLKEKISDSDKR 252 KLK ++S+ ++R Sbjct: 389 CSKLKLELSNCEER 402 >SB_44787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/52 (28%), Positives = 28/52 (53%) Frame = -3 Query: 422 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKIS 267 K+E R+ +EAEK E++K K+ + + + Y ++ + K K+K S Sbjct: 467 KDEQSRLFDEAEKLEKENNKLKDEVGSLSKEIEYLKNLMLEVYQTKQKQKES 518 >SB_32331| Best HMM Match : DivIVA (HMM E-Value=0.86) Length = 888 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/62 (22%), Positives = 33/62 (53%) Frame = -3 Query: 458 KITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLK 279 ++ I +D G L ++ N+ +K E+D+ +E + E++ SM+ + D++ + Sbjct: 618 EVKIYDDDGDLKVSKLTGFFNDDDKEEEEEDRAEECEET----EAHIISMQEEVNDDETE 673 Query: 278 EK 273 E+ Sbjct: 674 EE 675 >SB_7623| Best HMM Match : SURF6 (HMM E-Value=2.6) Length = 256 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -3 Query: 422 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 255 K E+E+ E EK R E +KQ+ + K LES E+ K+ I D++K Sbjct: 105 KNEVEKERQEEEKRRMEIEKQRMESEKKRILES------KQKRIEESKDTIHDNEK 154 >SB_26915| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3934 Score = 28.3 bits (60), Expect = 5.0 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -3 Query: 392 AEKYRNEDDKQKETIQAKNALESYCFSMKSTMED-EKLKEKISDSDKR 252 AEKY +E ++K+ ++ LES + +E EK + S+ ++R Sbjct: 2091 AEKYEHESQEKKKIVEISETLESKNRKQQELLESLEKKLSEFSEKEER 2138 >SB_24447| Best HMM Match : TolA (HMM E-Value=1.3) Length = 325 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/49 (24%), Positives = 29/49 (59%) Frame = -3 Query: 467 KEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY 321 K+ +I N + ++ KE+ +M+ ++ K RN+ + + ++N L++Y Sbjct: 76 KQLEINKLNRELKVLKEDYAKMIVKSYKSRNDQSRVMFVLSSQNFLQAY 124 >SB_23774| Best HMM Match : Kinesin (HMM E-Value=0) Length = 805 Score = 28.3 bits (60), Expect = 5.0 Identities = 17/55 (30%), Positives = 31/55 (56%) Frame = -3 Query: 419 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 255 EE+E + + E+ R+ + Q ET++ +N E K T E++ LKE I+ ++ Sbjct: 54 EELEDRIAKLEEERDNLEVQLETVRKENDTE----MEKQTNENDTLKETITGHEE 104 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 28.3 bits (60), Expect = 5.0 Identities = 19/56 (33%), Positives = 28/56 (50%) Frame = -3 Query: 422 KEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISDSDK 255 K E+E+ E EK R E +KQ+ + K LES E+ K+ I D++K Sbjct: 223 KNEVEKERQEEEKRRMEIEKQRMESEKKRILES------KQKRIEESKDTIHDNEK 272 >SB_54892| Best HMM Match : DHH (HMM E-Value=0.057) Length = 384 Score = 27.9 bits (59), Expect = 6.6 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 1/63 (1%) Frame = -3 Query: 440 DKGRLSKEEIERMVNEAEKYRNED-DKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 264 DK + + EE+ VNEA K E KQ++T Q+ + + C ++ E+ S+ Sbjct: 156 DKVKFNLEELYHSVNEATKRNTEAIQKQRQTRQSPASPGTICRLYNKKLDFEQFDYGFSE 215 Query: 263 SDK 255 + K Sbjct: 216 TIK 218 >SB_40334| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1061 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/62 (25%), Positives = 30/62 (48%) Frame = -3 Query: 443 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 264 +D ++ EE E ++AE E D++ +A ++ S +D++L EK+ D Sbjct: 975 SDASHVTSEE-EMQASDAESEEKEKDEESSDAEAPSSSRKRVISSD---DDDELDEKLDD 1030 Query: 263 SD 258 D Sbjct: 1031 DD 1032 >SB_50337| Best HMM Match : Extensin_1 (HMM E-Value=0.19) Length = 86 Score = 27.9 bits (59), Expect = 6.6 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 71 PEPEVPPPGLEALAPPSRRSIKP 3 P+P+ PPPG PPS + P Sbjct: 28 PKPDTPPPGTNIPTPPSPNTPPP 50 >SB_20161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 475 Score = 27.9 bits (59), Expect = 6.6 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 7/42 (16%) Frame = -2 Query: 255 ETILDKCNDTIKWLDSN------QLADK-EEYEHKQKELEGI 151 E +++C TIK LDSN Q+AD+ EE + ++ELE + Sbjct: 192 EKEVNRCEATIKTLDSNLKDLRQQVADRDEELNNNRQELESV 233 >SB_11774| Best HMM Match : M (HMM E-Value=8.5e-09) Length = 1998 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -3 Query: 419 EEIERMVNE-AEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEKISD 264 E+ E+++ + AEK R +K+KE + E F + + +DE L +K+ D Sbjct: 1446 EKREKVLQDGAEKDRKGFEKEKEEFEEAFRKEKKIFQDELSKKDEDLAQKLQD 1498 >SB_43252| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 699 Score = 27.5 bits (58), Expect = 8.7 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -2 Query: 258 QETILDKCNDTIKW-LDSNQLADKEEYEHKQKELEGIYNPIITKM 127 +E L + T+K+ LD +LA KE++ +KE EG + TKM Sbjct: 116 KEQELSELRKTVKYALDQEKLA-KEQFGDLKKEFEGYKKKMDTKM 159 >SB_28185| Best HMM Match : FIVAR (HMM E-Value=2.2) Length = 106 Score = 27.5 bits (58), Expect = 8.7 Identities = 20/82 (24%), Positives = 46/82 (56%), Gaps = 4/82 (4%) Frame = -3 Query: 503 ILNVSAIXKSTNKEXKIT-ITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNA-L 330 +++VS + + N + ++ + K +L+ E++E + +NE K+KET+ A + L Sbjct: 1 MVSVSYLQINNNLKGEVRELYESKSKLA-EQLENSRQLIKSIKNEHKKEKETLTALTSDL 59 Query: 329 ESYCFSMKSTMEDEK--LKEKI 270 + + K T++ E+ L++K+ Sbjct: 60 QQKLGAAKDTLDRERRTLRDKL 81 >SB_12264| Best HMM Match : Filament (HMM E-Value=0.0075) Length = 762 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/72 (22%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = -3 Query: 467 KEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNA-LESYCFSMKSTMED 291 ++ I + N K + ++E+E+ E ++ + ++T+Q K A L ++K E+ Sbjct: 1 RDKTIGVLNSKVKNMQQELEQYKKELQESLSISTVMEQTLQVKEASLIQAEETLKELQEN 60 Query: 290 EKLKEKISDSDK 255 ++ EK+ +K Sbjct: 61 QQYIEKVEQLEK 72 >SB_51415| Best HMM Match : zf-CCCH (HMM E-Value=1.1) Length = 332 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/61 (26%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = -3 Query: 497 NVSAIXKSTNKEXKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQ--KETIQAKNALES 324 NVS + K K+ + GR K ++ + EK++ + K+ +E Q K A++ Sbjct: 100 NVSVLVKPDCKQDAVKEQKPSGRKLKRKLYKQRKRQEKFKKIEKKKAIREQKQQKAAIQR 159 Query: 323 Y 321 Y Sbjct: 160 Y 160 >SB_44544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1480 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +3 Query: 57 HLRLRVLRPGSPAYLRGLLRHPGTSS*LSDCKCLPILSACAH 182 HL +RVL P P L LS C CLP+ +C H Sbjct: 1140 HLSVRVLSPVCPRVFTCLYACVN----LSVCVCLPVCFSCVH 1177 Score = 27.5 bits (58), Expect = 8.7 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = +3 Query: 57 HLRLRVLRPGSPAYLRGLLRHPGTSS*LSDCKCLPILSACAH 182 HL +RVL P P L LS C CLP+ +C H Sbjct: 1177 HLSVRVLSPVCPRVFTCLYACVN----LSVCVCLPVCFSCVH 1214 >SB_23299| Best HMM Match : zf-C3HC4 (HMM E-Value=5.9e-06) Length = 418 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -3 Query: 419 EEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEK 285 E E + N+ ++ +DDK++ET K + + S EDEK Sbjct: 40 EAAEEVENKMDEMSVKDDKREETQSDKKSAKESTKSSSKPAEDEK 84 >SB_20481| Best HMM Match : Pox_A_type_inc (HMM E-Value=5.60519e-45) Length = 4160 Score = 27.5 bits (58), Expect = 8.7 Identities = 20/64 (31%), Positives = 37/64 (57%) Frame = -3 Query: 452 TITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKEK 273 T+ ND ++K+E+ER+ +K D+K+KE ++ K L+ TME ++L+ Sbjct: 3498 TVDND---ITKDELERL----KKIVENDEKEKENLKRK--LQG--SDSDGTMERKRLQRD 3546 Query: 272 ISDS 261 +SD+ Sbjct: 3547 MSDA 3550 >SB_18255| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1457 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 1/57 (1%) Frame = -3 Query: 422 KEEIERMVNEAEKYRNEDDKQKETIQ-AKNALESYCFSMKSTMEDEKLKEKISDSDK 255 KE E +NE +KY N+ K +Q KNAL+ + S D L K + ++ Sbjct: 811 KERSEAWLNEKQKYTNDIKHIKTEVQLCKNALDGTKQKVLSLENDLLLTSKQLEKER 867 >SB_8472| Best HMM Match : TatC (HMM E-Value=1.4) Length = 476 Score = 27.5 bits (58), Expect = 8.7 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -3 Query: 167 KNWKAFTIR*LRRCTRVPEESPEVCRASRAEHPEPEVP 54 KN+ ++ L R P+E ++ SR PEP P Sbjct: 8 KNFDEVVVQLLMRMYEPPDEGSDIATFSRESDPEPNPP 45 >SB_3240| Best HMM Match : Sec8_exocyst (HMM E-Value=0.48) Length = 643 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = -3 Query: 431 RLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESYCFSMKSTMEDEKLKE 276 R S EE+ R E E E K +ETIQ N E MK + D+ ++ Sbjct: 380 RASVEELVRTRKELEMKEKELQKAQETIQQMNEREQ---QMKERLADQAQRQ 428 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,199,674 Number of Sequences: 59808 Number of extensions: 332769 Number of successful extensions: 1739 Number of sequences better than 10.0: 54 Number of HSP's better than 10.0 without gapping: 1500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1718 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -