BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0343.Seq (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0141 + 23079516-23079925,23080006-23080084,23080204-230803... 29 2.1 02_04_0360 + 22353057-22353691,22354716-22355144,22355233-223553... 27 6.3 12_02_0031 - 12477787-12478413,12480182-12480268,12480371-124805... 27 8.4 08_01_0143 - 1125211-1126414,1129217-1129368 27 8.4 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 27 8.4 >04_04_0141 + 23079516-23079925,23080006-23080084,23080204-23080326, 23081655-23081771,23081886-23081945 Length = 262 Score = 29.1 bits (62), Expect = 2.1 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +2 Query: 71 KNESTKRGTAITIFKCIHKLKTTQSHKVMQGLLKLMFPFVIPRSYHHGSRCRCLRNCFDY 250 K ES +T+ K T+ K+ G+LKL+ ++P S S+ L+ DY Sbjct: 76 KEESRGNEDRVTLIKDYRGKIETELTKICDGILKLLESHLVPSSTAPESKVFYLKMKGDY 135 Query: 251 Y 253 Y Sbjct: 136 Y 136 >02_04_0360 + 22353057-22353691,22354716-22355144,22355233-22355311, 22355472-22355594,22356256-22356372,22356636-22356833 Length = 526 Score = 27.5 bits (58), Expect = 6.3 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = +2 Query: 71 KNESTKRGTAITIFKCIHKLKTTQSHKVMQGLLKLMFPFVIPRSYHHGSRCRCLRNCFDY 250 K ES T+ K T+ K+ G+LKL+ ++P S S+ L+ DY Sbjct: 294 KEESRGNEDRCTLIKEYRGKIETELSKICDGILKLLDSHLVPSSTAPESKVFYLKMKGDY 353 Query: 251 Y 253 Y Sbjct: 354 Y 354 >12_02_0031 - 12477787-12478413,12480182-12480268,12480371-12480562, 12480638-12480766,12480840-12480926,12483076-12483537, 12485088-12485222 Length = 572 Score = 27.1 bits (57), Expect = 8.4 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -2 Query: 201 LRGMTNGNINFNKPCITLWLCVVLSL*MHLKIVMAVP 91 L G+T G N +TL++C+VL + + I VP Sbjct: 406 LTGLTRGGSNIAYFVVTLYMCIVLVESIMMVIAAVVP 442 >08_01_0143 - 1125211-1126414,1129217-1129368 Length = 451 Score = 27.1 bits (57), Expect = 8.4 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 5/53 (9%) Frame = +2 Query: 77 ESTKRGTAITIFKCIHKLKTTQSHKVMQGLLKLMFPFVIPR-----SYHHGSR 220 EST+ + CI+K+ + ++Q L + + +P YHHG+R Sbjct: 30 ESTETALGAEVHLCINKIMIHRYPAILQNLKMDYYRYFVPSVVAIGPYHHGAR 82 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 27.1 bits (57), Expect = 8.4 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 140 QSHKVMQGLLKLMFPFVIPRSYHHGSRC 223 +S ++Q L KLM PF P Y S C Sbjct: 1861 KSKVIVQRLSKLMEPFAFPSDYSRTSSC 1888 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,488,672 Number of Sequences: 37544 Number of extensions: 140806 Number of successful extensions: 258 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 256 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 258 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -