BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0342.Seq (449 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0021 - 155700-156023 34 0.061 11_01_0023 - 162079-162402 34 0.061 01_05_0378 + 21628517-21628759 33 0.14 12_01_0474 + 3718846-3719097 29 1.3 11_06_0372 + 22781438-22781977 27 9.2 >12_01_0021 - 155700-156023 Length = 107 Score = 33.9 bits (74), Expect = 0.061 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 Query: 264 MWRFYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGKYTRA 389 M RFYTD++ MSL FI V LH++GK R+ Sbjct: 58 MLRFYTDEAPGLRLSPTMVLVMSLCFIGFVTALHVFGKLYRS 99 >11_01_0023 - 162079-162402 Length = 107 Score = 33.9 bits (74), Expect = 0.061 Identities = 17/42 (40%), Positives = 22/42 (52%) Frame = +3 Query: 264 MWRFYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGKYTRA 389 M RFYTD++ MSL FI V LH++GK R+ Sbjct: 58 MLRFYTDEAPGLRLSPTMVLVMSLCFIGFVTALHVFGKLYRS 99 >01_05_0378 + 21628517-21628759 Length = 80 Score = 32.7 bits (71), Expect = 0.14 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +3 Query: 264 MWRFYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGKYTR 386 M +FYTD++ MS+ FIA V +LH++GK R Sbjct: 37 MLQFYTDEAAGRKMSPNSVLIMSIGFIAVVALLHVFGKLYR 77 >12_01_0474 + 3718846-3719097 Length = 83 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 264 MWRFYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGKYTR 386 M +FYT+++ MS+ F A V +LH++GK R Sbjct: 39 MLQFYTEEAAGCKMSPNAVLIMSIGFFAVVALLHVFGKLYR 79 >11_06_0372 + 22781438-22781977 Length = 179 Score = 26.6 bits (56), Expect = 9.2 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = +1 Query: 115 SATSVGSGSRSPTKASAGPRTA 180 S GSGSRSP+KA+ P A Sbjct: 3 SGDEEGSGSRSPSKAAPAPAPA 24 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,738,507 Number of Sequences: 37544 Number of extensions: 166569 Number of successful extensions: 375 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 375 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 871620292 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -