BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0342.Seq (449 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC025715-6|AAK68450.1| 81|Caenorhabditis elegans Hypothetical ... 62 2e-10 Z81104-1|CAB70255.1| 329|Caenorhabditis elegans Hypothetical pr... 28 3.6 >AC025715-6|AAK68450.1| 81|Caenorhabditis elegans Hypothetical protein Y38F2AR.9 protein. Length = 81 Score = 62.1 bits (144), Expect = 2e-10 Identities = 26/45 (57%), Positives = 33/45 (73%) Frame = +3 Query: 255 SGGMWRFYTDDSXXXXXXXXXXXXMSLLFIASVFMLHIWGKYTRA 389 +GG+WRFYT+DS MSL+FIASVF+LHIWGK+TR+ Sbjct: 35 NGGLWRFYTEDSTGLKIGPVPVLVMSLVFIASVFVLHIWGKFTRS 79 >Z81104-1|CAB70255.1| 329|Caenorhabditis elegans Hypothetical protein M199.1 protein. Length = 329 Score = 27.9 bits (59), Expect = 3.6 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +3 Query: 216 YYNCSQKPKHWCWSGGMWR 272 +YNCS KP+ WS G+ R Sbjct: 15 FYNCSWKPQSEWWSNGVQR 33 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,422,216 Number of Sequences: 27780 Number of extensions: 146930 Number of successful extensions: 235 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 232 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 235 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 788595652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -