BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0339.Seq (419 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5196| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.68 SB_16055| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_15801| Best HMM Match : eRF1_2 (HMM E-Value=4.8) 27 8.3 >SB_5196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 412 Score = 30.3 bits (65), Expect = 0.68 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -2 Query: 415 PPQARPGQAQPLQAVXLPRAVQVHRTLPPLXLVFPGVI 302 P +RP A P LP+ V R LP L VFPG++ Sbjct: 318 PSISRPATAPPPVFRGLPQLPPVFRCLPQLPPVFPGLL 355 >SB_16055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 28.3 bits (60), Expect = 2.7 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = -2 Query: 298 QA*TDFYTSLVKEK*PLLRKHIRYSLPSP*EYRCLIQLNTTWSIPCSV 155 Q+ +Y VKEK H+ + P RC I+LN WS PC V Sbjct: 738 QSQKSYYDCWVKEKIFKKGDHVLWFDKKPRRGRC-IKLNRPWSGPCIV 784 >SB_15801| Best HMM Match : eRF1_2 (HMM E-Value=4.8) Length = 562 Score = 26.6 bits (56), Expect = 8.3 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +3 Query: 195 KHRYSYGDGKEYRICFRSKGYFSLTRLV 278 +H +S GD ++ IC SK Y L R V Sbjct: 432 EHEFSLGDAEKEFICATSKAYEELIRNV 459 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,890,430 Number of Sequences: 59808 Number of extensions: 221000 Number of successful extensions: 336 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 335 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -