BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0333.Seq (528 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0010 - 12139533-12139571,12140893-12141230,12141235-12141721 28 4.0 10_06_0101 + 10736987-10737100,10737263-10737301,10737397-107374... 28 5.3 06_03_1480 - 30432718-30432996,30433151-30434123,30434251-304345... 27 7.1 04_03_0027 + 9667508-9668800 27 7.1 01_06_1749 - 39636951-39638102 27 7.1 07_01_0547 + 4052618-4052659,4055575-4055741,4055839-4056556,405... 27 9.3 06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-92... 27 9.3 >11_04_0010 - 12139533-12139571,12140893-12141230,12141235-12141721 Length = 287 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = -2 Query: 113 YISRWVAHLPCRFLWAPVST*HQMXCELVHP 21 Y+S+WV +PCR +A + QM E++ P Sbjct: 38 YVSKWVEAMPCRAAYAKHA--RQMFHEIIFP 66 >10_06_0101 + 10736987-10737100,10737263-10737301,10737397-10737474, 10737539-10737685,10737781-10737888,10738115-10738449, 10738572-10739544,10739702-10739980 Length = 690 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 85 LVDFYGLQYPLNTRWXV 35 L+ FY L YPLN W V Sbjct: 614 LITFYNLTYPLNRNWHV 630 >06_03_1480 - 30432718-30432996,30433151-30434123,30434251-30434585, 30434929-30435075,30435498-30435569 Length = 601 Score = 27.5 bits (58), Expect = 7.1 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -3 Query: 85 LVDFYGLQYPLNTRWXV 35 L+ FY L YPLN W V Sbjct: 525 LITFYNLTYPLNRTWHV 541 >04_03_0027 + 9667508-9668800 Length = 430 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 113 YISRWVAHLPCRFLWAPVST*HQMXCELVHP 21 Y+S+WV +PCR A H+M E++ P Sbjct: 286 YVSKWVEAMPCRA--ANTKHAHRMFDEIIFP 314 >01_06_1749 - 39636951-39638102 Length = 383 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = +2 Query: 128 SIVTTAAPPFKPKRITASRQK*AGRWYLSARTHK 229 S+ + AAPPF P RIT+ GR + + K Sbjct: 165 SVASAAAPPFDPSRITSYAAHPNGRAFFVSVARK 198 >07_01_0547 + 4052618-4052659,4055575-4055741,4055839-4056556, 4056678-4057114,4057241-4057315,4057490-4057673, 4057759-4057854,4057952-4058018,4058556-4058715, 4058808-4059199,4059254-4059300 Length = 794 Score = 27.1 bits (57), Expect = 9.3 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 349 QNWYTEELERLLKFAAXGAVPTAYKVE 429 +N TEE++ L + A G++PT YKVE Sbjct: 286 KNISTEEIQDNL-YEANGSIPTGYKVE 311 >06_01_0120 - 926226-926289,926821-926887,927122-927170,927257-927313, 927826-927897,928145-928236,928331-928403,928870-928944, 929207-929314,929372-929422,929834-929959,930324-930362, 930452-930535,931018-931109,931217-931300,931410-931524 Length = 415 Score = 27.1 bits (57), Expect = 9.3 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = +1 Query: 253 HL*FYGFHLYYTMLSLHRGSQS*TFFEYVIH 345 H+ FY HL Y + RG+Q + F ++H Sbjct: 199 HVPFYRLHLKYHLWKQFRGAQRRSIFRLLLH 229 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,984,264 Number of Sequences: 37544 Number of extensions: 239719 Number of successful extensions: 415 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 415 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1166441080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -