BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0332.Seq (548 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 31 0.005 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 22 4.1 AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 prot... 21 5.4 AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochr... 21 9.4 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 31.5 bits (68), Expect = 0.005 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = -1 Query: 338 TDDMLRKRVSITADAVHRQRGAQMQLRAFNRNNFSIRYWSWNYRGCWHQTC 186 TD K + D R+R + R+NF + WNY CW C Sbjct: 716 TDSAGDKYSRLVGDGSARRRFVVAVVGFLRRHNFKGLHLDWNYPVCWQSNC 766 Score = 23.0 bits (47), Expect = 1.8 Identities = 8/20 (40%), Positives = 8/20 (40%) Frame = -1 Query: 245 NNFSIRYWSWNYRGCWHQTC 186 NNF W Y CW C Sbjct: 1935 NNFDGLDLDWEYPKCWQVDC 1954 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/34 (29%), Positives = 13/34 (38%) Frame = -1 Query: 287 RQRGAQMQLRAFNRNNFSIRYWSWNYRGCWHQTC 186 R R + L+ + NF W Y CW C Sbjct: 1496 RARFIKHVLQFLEKWNFDGLDLDWEYPKCWQVDC 1529 Score = 20.6 bits (41), Expect = 9.4 Identities = 7/19 (36%), Positives = 7/19 (36%) Frame = -1 Query: 242 NFSIRYWSWNYRGCWHQTC 186 NF W Y CW C Sbjct: 2434 NFDGLDLDWEYPKCWQVDC 2452 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.8 bits (44), Expect = 4.1 Identities = 5/16 (31%), Positives = 9/16 (56%) Frame = -1 Query: 239 FSIRYWSWNYRGCWHQ 192 +++ YW Y WH+ Sbjct: 117 YAVYYWRQQYEDFWHR 132 >AY873916-1|AAW67572.1| 377|Tribolium castaneum chitinase 6 protein. Length = 377 Score = 21.4 bits (43), Expect = 5.4 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = -1 Query: 311 SITADAVHRQRGAQMQLRAFNRNNFSIRYWSWNY 210 ++ ADA R A+ L F NF W Y Sbjct: 111 AVAADATKRATMAKSALEFFETYNFDGLDVDWEY 144 >AF264721-1|AAF75273.1| 126|Tribolium castaneum putative cytochrome P450 monooxigenaseCYP4Q2 protein. Length = 126 Score = 20.6 bits (41), Expect = 9.4 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = +1 Query: 367 NIKILSRCSSVSVEVGPTILL 429 N+K L RC S+ + P++ L Sbjct: 44 NLKYLERCIKESLRLYPSVHL 64 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,712 Number of Sequences: 336 Number of extensions: 2628 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13516233 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -