BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0332.Seq (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|ch... 26 3.2 SPBC530.05 |||transcription factor |Schizosaccharomyces pombe|ch... 25 5.6 >SPCC1393.07c |mug4||sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 845 Score = 26.2 bits (55), Expect = 3.2 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = -1 Query: 149 LIPITRPRKSPVSLFFVTTSPCREWVICAPAAFL 48 +IPI + KS +SL F+T SPC + IC+ A L Sbjct: 45 IIPIAQ--KSNISLPFLTLSPC-SFTICSLRARL 75 >SPBC530.05 |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 743 Score = 25.4 bits (53), Expect = 5.6 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +1 Query: 451 SGLKMLLEYFVHGIIEYDLVLFCWXSELP 537 SG+K + I+E+DL+L W + LP Sbjct: 411 SGMKSNSSQVMEKILEFDLLLNNWYNSLP 439 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,192,873 Number of Sequences: 5004 Number of extensions: 42591 Number of successful extensions: 84 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -