BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0331.Seq (608 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF099918-3|AAN63401.1| 436|Caenorhabditis elegans Hypothetical ... 29 2.6 Z81513-3|CAB04185.3| 476|Caenorhabditis elegans Hypothetical pr... 27 7.9 >AF099918-3|AAN63401.1| 436|Caenorhabditis elegans Hypothetical protein H05C05.2a protein. Length = 436 Score = 29.1 bits (62), Expect = 2.6 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = -1 Query: 503 FIIYAIHFGKNMHTQILPN*KSVFYFPKHKILTY*KNCTQNMKSFFKNT 357 F+ + KN + N SVF+ KHK+ +Y + + FF T Sbjct: 14 FVEFCAEIAKNSVKPVTRNKLSVFFNKKHKLTSYPSHFARTFDRFFVET 62 >Z81513-3|CAB04185.3| 476|Caenorhabditis elegans Hypothetical protein F26D2.3a protein. Length = 476 Score = 27.5 bits (58), Expect = 7.9 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = -1 Query: 473 NMHTQILPN*KSVFYFPKHKILTY*KNCTQNMK 375 N+ I N SV Y HK Y NCT N K Sbjct: 436 NLEDDIYKNLVSVQYHENHKKSDYKLNCTSNFK 468 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,838,334 Number of Sequences: 27780 Number of extensions: 257461 Number of successful extensions: 460 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 455 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 460 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1311096392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -