BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0331.Seq (608 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g30695.2 68415.m03744 expressed protein 29 3.2 At2g30695.1 68415.m03743 expressed protein 29 3.2 At5g17700.1 68418.m02074 MATE efflux family protein similar to r... 28 5.6 At1g55420.1 68414.m06339 DC1 domain-containing protein contains ... 28 5.6 >At2g30695.2 68415.m03744 expressed protein Length = 199 Score = 28.7 bits (61), Expect = 3.2 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 520 Q*VLHSINFCSFSSYIFNP 576 Q ++HS++FCSF+S NP Sbjct: 2 QTIIHSLSFCSFNSTTINP 20 >At2g30695.1 68415.m03743 expressed protein Length = 199 Score = 28.7 bits (61), Expect = 3.2 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +1 Query: 520 Q*VLHSINFCSFSSYIFNP 576 Q ++HS++FCSF+S NP Sbjct: 2 QTIIHSLSFCSFNSTTINP 20 >At5g17700.1 68418.m02074 MATE efflux family protein similar to ripening regulated protein DDTFR18 [Lycopersicon esculentum] GI:12231296; contains Pfam profile PF01554: Uncharacterized membrane protein family Length = 497 Score = 27.9 bits (59), Expect = 5.6 Identities = 13/46 (28%), Positives = 21/46 (45%) Frame = +3 Query: 348 VKSSIFKKRFHVLCTIFLVGQYFMFWEIKYTFSIRQNLCVHVLTEM 485 V S + K ++ + F + QY WE+ F + CV V E+ Sbjct: 280 VLMSGYAKDANIAISAFSICQYIYSWEMNICFGLMGAACVRVANEL 325 >At1g55420.1 68414.m06339 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 725 Score = 27.9 bits (59), Expect = 5.6 Identities = 15/50 (30%), Positives = 24/50 (48%) Frame = -3 Query: 333 CESKKPLYSTSTLTVTRKRNVLKS*T*N*NSICYYRRQCSLEI*KCCHCF 184 C ++P Y ++ T K L+S ++ YY C+LE + CH F Sbjct: 27 CRRRRPSYPPLSICFTCKGKQLRS-----SAYYYYCATCNLEFHRGCHIF 71 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,365,656 Number of Sequences: 28952 Number of extensions: 210022 Number of successful extensions: 284 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 280 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 284 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -