BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0330.Seq (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 comple... 27 2.7 SPAC13G6.05c |||TRAPP complex subunit Bet3 |Schizosaccharomyces ... 27 2.7 >SPBC1105.07c |||nuclear pore associated protein Thp1-Sac3 complex subunit |Schizosaccharomyces pombe|chr 2|||Manual Length = 442 Score = 26.6 bits (56), Expect = 2.7 Identities = 14/48 (29%), Positives = 26/48 (54%) Frame = -1 Query: 223 YIRRCCTNKSSLNLAQCHLIFPYAFIFD*TKPFERYTLVMLTTRVFVL 80 Y+ RC + ++ A+ HL+F + D +R +L+ LTT + +L Sbjct: 229 YLGRCHLYQRKIHQAKDHLLFSFLQCPDECYHQKRLSLIYLTTCLLIL 276 >SPAC13G6.05c |||TRAPP complex subunit Bet3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 245 Score = 26.6 bits (56), Expect = 2.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +3 Query: 42 SNTFFYWKVKYRIKTKTRVVNITSVY 119 ++T+FYW K T T + IT+ Y Sbjct: 102 TDTYFYWFTKMTAMTGTEMAQITTPY 127 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,553,557 Number of Sequences: 5004 Number of extensions: 26443 Number of successful extensions: 50 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 50 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 50 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -