BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0330.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) 33 0.23 SB_50933| Best HMM Match : Laminin_EGF (HMM E-Value=0.0069) 29 2.9 >SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) Length = 338 Score = 32.7 bits (71), Expect = 0.23 Identities = 24/85 (28%), Positives = 39/85 (45%), Gaps = 8/85 (9%) Frame = -3 Query: 245 RFAYFIKLYTSMLHEQI*FKFSTMSFNFSLCFYI*LNKAI*TVYTCNVNY-PCFCFNSVF 69 R A+ +L ++ LHE++ +K +S L FY+ + V C +N P C N F Sbjct: 242 RRAWMRRLTSNSLHERVNYKVFKISLAIVLAFYLCYSCYWLQVTLCTLNEPPRLCANQTF 301 Query: 68 -----YFPIKKCVA--VICGSFNKR 15 Y I C ++C +F+ R Sbjct: 302 RFMNVYLAIANCAVNPIVCLAFSSR 326 >SB_50933| Best HMM Match : Laminin_EGF (HMM E-Value=0.0069) Length = 233 Score = 29.1 bits (62), Expect = 2.9 Identities = 12/34 (35%), Positives = 14/34 (41%) Frame = +2 Query: 290 GSVLSTACRRGCRTTAGSCYGRTAASCRCCGCSW 391 G + AC C G C+G TA C C W Sbjct: 61 GKMSCKACHESC---FGGCHGGTAKDCSACKSGW 91 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,314,490 Number of Sequences: 59808 Number of extensions: 184142 Number of successful extensions: 441 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 401 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 440 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -