BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0330.Seq (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical pr... 28 4.4 Z81503-1|CAB04111.1| 305|Caenorhabditis elegans Hypothetical pr... 28 4.4 Z66499-4|CAA91301.1| 164|Caenorhabditis elegans Hypothetical pr... 28 4.4 U58760-7|AAK31463.1| 188|Caenorhabditis elegans Hypothetical pr... 28 4.4 U55854-7|AAK68158.1| 166|Caenorhabditis elegans Hypothetical pr... 28 4.4 U55854-6|AAK68161.1| 197|Caenorhabditis elegans Hypothetical pr... 28 4.4 Z81132-8|CAB03429.1| 90|Caenorhabditis elegans Hypothetical pr... 28 5.8 Z81055-4|CAB02893.1| 824|Caenorhabditis elegans Hypothetical pr... 27 7.7 Z81038-16|CAN99683.1| 400|Caenorhabditis elegans Hypothetical p... 27 7.7 Z81038-15|CAB02769.1| 404|Caenorhabditis elegans Hypothetical p... 27 7.7 >Z81579-4|CAE17915.1| 212|Caenorhabditis elegans Hypothetical protein R13H4.8 protein. Length = 212 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Frame = +2 Query: 311 CRRGCRTTAGSCYGRTAASCR--CCGC 385 CRR C C R CR CCGC Sbjct: 97 CRRCCTCCRTCCCTRCCTCCRPCCCGC 123 >Z81503-1|CAB04111.1| 305|Caenorhabditis elegans Hypothetical protein F14F7.1 protein. Length = 305 Score = 28.3 bits (60), Expect = 4.4 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 451 QREGGANGGDGNCSNCQKGSP 389 Q +GG GG G CS C + P Sbjct: 88 QPQGGGGGGGGQCSTCCRPGP 108 >Z66499-4|CAA91301.1| 164|Caenorhabditis elegans Hypothetical protein T01B7.8 protein. Length = 164 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Frame = +2 Query: 311 CRRGCRTTAGSCYGRTAASCR--CCGC 385 CRR C C R CR CCGC Sbjct: 95 CRRCCTCCRTCCCTRCCTCCRPCCCGC 121 >U58760-7|AAK31463.1| 188|Caenorhabditis elegans Hypothetical protein C27A2.5 protein. Length = 188 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Frame = +2 Query: 311 CRRGCRTTAGSCYGRTAASCR--CCGC 385 CRR C C R CR CCGC Sbjct: 96 CRRCCTCCRTCCCTRCCTCCRPCCCGC 122 >U55854-7|AAK68158.1| 166|Caenorhabditis elegans Hypothetical protein C04G6.10 protein. Length = 166 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Frame = +2 Query: 311 CRRGCRTTAGSCYGRTAASCR--CCGC 385 CRR C C R CR CCGC Sbjct: 96 CRRCCTCCRTCCCTRCCTCCRPCCCGC 122 >U55854-6|AAK68161.1| 197|Caenorhabditis elegans Hypothetical protein C04G6.7 protein. Length = 197 Score = 28.3 bits (60), Expect = 4.4 Identities = 12/27 (44%), Positives = 12/27 (44%), Gaps = 2/27 (7%) Frame = +2 Query: 311 CRRGCRTTAGSCYGRTAASCR--CCGC 385 CRR C C R CR CCGC Sbjct: 97 CRRCCTCCRTCCCTRCCTCCRPCCCGC 123 >Z81132-8|CAB03429.1| 90|Caenorhabditis elegans Hypothetical protein T26E4.10 protein. Length = 90 Score = 27.9 bits (59), Expect = 5.8 Identities = 16/72 (22%), Positives = 29/72 (40%), Gaps = 8/72 (11%) Frame = +2 Query: 200 VRATSTYII**NKQNGVLFFLDFIT*KIKLGSVLSTACRRGCRTTAGSCYGRTA------ 361 + T + ++ N++ + D + + LG ++ + GC C G T Sbjct: 17 ISTTFSNVVQGNEETALDSTYDMVPGEGVLGQLIRAKRQWGCGCDCWGCCGPTPDPAATP 76 Query: 362 --ASCRCCGCSW 391 +C CCGC W Sbjct: 77 APCNCGCCGCGW 88 >Z81055-4|CAB02893.1| 824|Caenorhabditis elegans Hypothetical protein F01G10.5 protein. Length = 824 Score = 27.5 bits (58), Expect = 7.7 Identities = 17/54 (31%), Positives = 31/54 (57%) Frame = +1 Query: 73 TELKQKHG*LTLQVYTVQMALFNQI*KHREKLNDIVLNLN*ICSCNIDVYNLMK 234 +EL +K LT+QV +Q A N++ R+K +++ L + N+D+ L+K Sbjct: 324 SELNEK---LTMQVKDLQDASENELASFRQKEKELIDELRMATNENVDLEELLK 374 >Z81038-16|CAN99683.1| 400|Caenorhabditis elegans Hypothetical protein C25A1.9b protein. Length = 400 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 192 LDLFVQHRRI*FNEISKTVYCFF*ILSLKKSNL 290 +D+F ++RRI E K CF I+ K +L Sbjct: 41 MDIFAENRRIDVEEFKKNAECFLNIIRSNKIDL 73 >Z81038-15|CAB02769.1| 404|Caenorhabditis elegans Hypothetical protein C25A1.9a protein. Length = 404 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 192 LDLFVQHRRI*FNEISKTVYCFF*ILSLKKSNL 290 +D+F ++RRI E K CF I+ K +L Sbjct: 41 MDIFAENRRIDVEEFKKNAECFLNIIRSNKIDL 73 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,744,496 Number of Sequences: 27780 Number of extensions: 154936 Number of successful extensions: 480 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 480 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -