Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0327.Seq
         (421 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    21   3.7  
AY074761-1|AAL71874.1|  314|Tribolium castaneum ultrabithorax pr...    20   8.5  

>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 21.4 bits (43), Expect = 3.7
 Identities = 10/30 (33%), Positives = 14/30 (46%)
 Frame = -3

Query: 143 PNSDGFVCDTLAASGYFSCFVAFSQAYCDF 54
           P  +G VC T+ A    +C   F    C+F
Sbjct: 346 PCQNGGVCTTIHAGHKCTCPEGFYGKNCEF 375


>AY074761-1|AAL71874.1|  314|Tribolium castaneum ultrabithorax
           protein.
          Length = 314

 Score = 20.2 bits (40), Expect = 8.5
 Identities = 5/5 (100%), Positives = 5/5 (100%)
 Frame = +1

Query: 379 HHHHH 393
           HHHHH
Sbjct: 53  HHHHH 57


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 87,391
Number of Sequences: 336
Number of extensions: 1525
Number of successful extensions: 2
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  9279512
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)