BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0326.Seq (598 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5AHV7 Cluster: Potential amino acid sensor system comp... 32 8.9 >UniRef50_Q5AHV7 Cluster: Potential amino acid sensor system component; n=5; Saccharomycetales|Rep: Potential amino acid sensor system component - Candida albicans (Yeast) Length = 880 Score = 32.3 bits (70), Expect = 8.9 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -2 Query: 510 FPSLTNLIIQNGEYIMVTMCITCVRFNIATK 418 F +LT+LI +G ++ TMC+T +RF K Sbjct: 729 FQNLTSLIASSGIFVWFTMCLTFIRFYYGLK 759 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 492,816,090 Number of Sequences: 1657284 Number of extensions: 8316685 Number of successful extensions: 13673 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 13379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13672 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41902926763 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -