BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0326.Seq (598 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 22 3.4 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 22 4.5 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 21 7.9 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 22.2 bits (45), Expect = 3.4 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +2 Query: 368 ARPSLTIKKKESYHLPCLVAILNLTQVM 451 A P + +E YH+P L +L+ VM Sbjct: 185 AVPIAKFRLQEGYHVPELCELLDAIHVM 212 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.8 bits (44), Expect = 4.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 525 KPFLSFPSLTNLIIQ 481 KPFL F S NL+I+ Sbjct: 33 KPFLFFGSFYNLVIR 47 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/37 (18%), Positives = 20/37 (54%) Frame = -2 Query: 216 IYQFNLIIHLTLFYP*GFICASLQYEINGNDFSFFYV 106 +Y+ ++ + + +ICA + Y ++ +F+Y+ Sbjct: 32 LYKIFVVFSFAVTFFSAWICALVNYNVSEISENFYYL 68 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,629 Number of Sequences: 336 Number of extensions: 2649 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -