BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0326.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_42482| Best HMM Match : 7tm_1 (HMM E-Value=0) 29 2.9 SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.6 >SB_42482| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 347 Score = 29.1 bits (62), Expect = 2.9 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 1/52 (1%) Frame = -2 Query: 513 SFPSLTNLIIQNGEYIMVTMCITCVRF-NIATKHGRW*DSFFLIVRDGLACF 361 S S TNL+IQN + M T + F I+ HGRW F+ D F Sbjct: 48 SLKSTTNLLIQNLSMTDIAMATTNMPFWLISLYHGRWIFPQFVCDLDSFTMF 99 >SB_25497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 27.9 bits (59), Expect = 6.6 Identities = 16/60 (26%), Positives = 28/60 (46%) Frame = -3 Query: 437 DSILQPNMVDGKILFF***GMVLHASLIKM*S*CSNET**KKFYINSRSFESYSFRYKFF 258 D++ Q + ILF+ ++HA L + + + T K+ Y N + +F Y FF Sbjct: 262 DTLEQRRLTSQAILFYKFHNSLIHAKLPDLVTRSTRSTRRKELYYNQLQANTLAFNYSFF 321 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,279,282 Number of Sequences: 59808 Number of extensions: 268636 Number of successful extensions: 408 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 361 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 408 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -