BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0325.Seq (449 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4.05 |mlo2||zinc finger protein Mlo2|Schizosaccharomyces pom... 26 2.3 SPBC19C2.12 |mrpl51||mitochondrial ribosomal protein subunit L51... 25 4.1 SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1... 24 9.4 >SPBC4.05 |mlo2||zinc finger protein Mlo2|Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 26.2 bits (55), Expect = 2.3 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 205 YRCLIXLXTTWSIPCSV*DFKSYLMTSNDFNDNF 104 +RC T SIPC++ + ND+N NF Sbjct: 85 FRCDCGTTRTHSIPCNLRKSVDECGSENDYNHNF 118 >SPBC19C2.12 |mrpl51||mitochondrial ribosomal protein subunit L51|Schizosaccharomyces pombe|chr 2|||Manual Length = 145 Score = 25.4 bits (53), Expect = 4.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = -2 Query: 439 RQCQQHRFHLKHVRGKHNHFRQFFYLGRVQV 347 ++ Q FH+ + +GKH R ++ GR +V Sbjct: 53 KESQDVEFHVTNRQGKHPLIRAYYNTGREKV 83 >SPAC4F10.15c |wsp1||WASp homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 574 Score = 24.2 bits (50), Expect = 9.4 Identities = 11/24 (45%), Positives = 14/24 (58%), Gaps = 1/24 (4%) Frame = -1 Query: 440 PTVPAAPIPPQA-RPGQAQPLQAV 372 P PAAP PP A P A P+ ++ Sbjct: 468 PLPPAAPAPPPAPAPAPAAPVASI 491 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,452,879 Number of Sequences: 5004 Number of extensions: 23199 Number of successful extensions: 44 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 166231220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -