BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0325.Seq (449 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_45852| Best HMM Match : I-set (HMM E-Value=0) 27 7.2 SB_37708| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.5 >SB_45852| Best HMM Match : I-set (HMM E-Value=0) Length = 1122 Score = 27.1 bits (57), Expect = 7.2 Identities = 13/30 (43%), Positives = 17/30 (56%), Gaps = 1/30 (3%) Frame = -2 Query: 442 HRQCQQHRFHLKHVRGKHN-HFRQFFYLGR 356 H Q QQH+FH H +N H+R F + R Sbjct: 1043 HHQ-QQHQFHHHHHHTHYNYHYRHFLIIDR 1071 >SB_37708| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 26.6 bits (56), Expect = 9.5 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = -1 Query: 437 TVPAAPIPPQARPGQAQPLQAV 372 ++P A IPPQ+ PG P Q++ Sbjct: 1050 SIPGASIPPQSIPGAFLPPQSI 1071 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,841,533 Number of Sequences: 59808 Number of extensions: 169705 Number of successful extensions: 334 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 332 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 896151577 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -