BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0324.Seq (548 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1A6.01c ||SPAC23C4.20c|human thyroid receptor interacting pr... 28 1.0 SPAC9E9.02 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual 25 9.7 >SPAC1A6.01c ||SPAC23C4.20c|human thyroid receptor interacting protein homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 455 Score = 27.9 bits (59), Expect = 1.0 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +1 Query: 187 SFYKTVSYTKKNLTVGILYSSMMDLKKLIFHNN 285 S ++ S T KN++ G++ S ++ KK + HNN Sbjct: 130 SSHEKSSKTTKNVSPGVMTSDLIPEKKSVKHNN 162 >SPAC9E9.02 |||dubious|Schizosaccharomyces pombe|chr 1|||Manual Length = 98 Score = 24.6 bits (51), Expect = 9.7 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 178 FVNSFYKTVSYTKKNLTVGILYSSMMDLKKLIFHN 282 F N+ +K KKN + I +SS++ ++ + F N Sbjct: 5 FANAKHKLHCLLKKNFLLTIRFSSLVSIQYIPFSN 39 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,951,097 Number of Sequences: 5004 Number of extensions: 37065 Number of successful extensions: 67 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 66 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 227943826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -