BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0324.Seq (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_06_0243 - 21813223-21813456,21814266-21814367,21814501-218147... 27 7.5 >09_06_0243 - 21813223-21813456,21814266-21814367,21814501-21814701, 21815591-21815716,21815791-21816072,21816218-21816388, 21816838-21816999,21817404-21817467,21818136-21818503 Length = 569 Score = 27.5 bits (58), Expect = 7.5 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 3/61 (4%) Frame = -1 Query: 383 HR*NVLVYTALAC*---YNPWAYIFFLNMKALKI*QLL*NINFFRSIIELYKIPTVRFFL 213 H N + + AC N W + F+N+ + K+ + L N R + ELY +R FL Sbjct: 304 HHENEIAQSRAACCDSSINYWIHNGFVNVNSQKMSKSLGNFVTIRKVTELYHPLALRMFL 363 Query: 212 V 210 + Sbjct: 364 L 364 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,401,514 Number of Sequences: 37544 Number of extensions: 167590 Number of successful extensions: 212 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 209 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 212 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -