BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0321.Seq (611 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC28F2.10c |kap1||chromatin remodeling complex subunit Ngg1 |S... 26 3.7 SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharom... 26 4.9 SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy... 25 8.6 >SPBC28F2.10c |kap1||chromatin remodeling complex subunit Ngg1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 551 Score = 26.2 bits (55), Expect = 3.7 Identities = 11/34 (32%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Frame = +1 Query: 328 FKNGRHRFESNLLIYVIDNNY-YNQKNKFLNVNN 426 +KN +LL +++D+++ Y QK K L V++ Sbjct: 171 YKNANDLLTGSLLSFIVDDSFSYEQKKKLLCVDS 204 >SPAC16A10.03c |||zinc finger protein Pep5/Vps11 |Schizosaccharomyces pombe|chr 1|||Manual Length = 860 Score = 25.8 bits (54), Expect = 4.9 Identities = 11/38 (28%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -3 Query: 336 ILKI-IRDLVINRHHAFLFYKSIKYCFFFYELRIMHVI 226 +LK +R+ I + + YK ++ CF + + I HV+ Sbjct: 696 VLKFFVRERSITNKYEDILYKILEACFMQFRIPIQHVL 733 >SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces pombe|chr 1|||Manual Length = 4924 Score = 25.0 bits (52), Expect = 8.6 Identities = 14/34 (41%), Positives = 20/34 (58%), Gaps = 4/34 (11%) Frame = -2 Query: 487 NMYVIFTVFSYSE*VYLLFECYLHS----KTCFF 398 N Y+ T S E +YLLF+ L++ +TCFF Sbjct: 1349 NKYLFETGKSSQEEIYLLFKTLLNNLPILRTCFF 1382 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,116,523 Number of Sequences: 5004 Number of extensions: 39228 Number of successful extensions: 76 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -