BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0321.Seq (611 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1079 - 30663919-30665044,30665143-30665298,30665405-306655... 27 8.9 >04_04_1079 - 30663919-30665044,30665143-30665298,30665405-30665563, 30665640-30665770,30666230-30666315,30666607-30666673, 30666944-30667023,30667173-30667260,30667380-30667428, 30667516-30667608,30667725-30667808,30667986-30668044, 30668293-30668327,30668416-30668718,30669111-30669275, 30669701-30669780,30670932-30671003,30671143-30671234, 30671359-30671433,30671552-30671688,30671763-30671890, 30671942-30672033,30672473-30672808 Length = 1230 Score = 27.5 bits (58), Expect = 8.9 Identities = 10/35 (28%), Positives = 23/35 (65%) Frame = -3 Query: 105 SNVKKTIILPFQFKTLSGCYIILDVSILLQIVKKK 1 SN+ ++++ F+F S CY++ + I+L+ ++ K Sbjct: 430 SNLSISLMIQFRFSDYSICYVLREEGIILKDLESK 464 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,858,632 Number of Sequences: 37544 Number of extensions: 166959 Number of successful extensions: 268 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 262 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 268 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1466594128 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -