BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0320.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 29 0.15 AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein p... 26 0.80 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 25 2.5 AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 24 3.2 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 24 3.2 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 24 4.3 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 28.7 bits (61), Expect = 0.15 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -2 Query: 366 KHYFNFKQTYEHLFLPLKNEKRCKYIKNSNAFCYCFKVYS 247 K +N +TY L L N+ CKY + A C+C Y+ Sbjct: 712 KLLYNRGRTYVPLVEALPNQFLCKYDTHCFALCHCCDFYA 751 >AB090814-1|BAC57903.1| 499|Anopheles gambiae gag-like protein protein. Length = 499 Score = 26.2 bits (55), Expect = 0.80 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -3 Query: 110 CPSPVSCPNRRCCRTW 63 CP ++ P+RRC R W Sbjct: 420 CPVRINIPSRRCYRCW 435 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 24.6 bits (51), Expect = 2.5 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -3 Query: 110 CPSPVSCPNRRCCRTW 63 CP + P RRC + W Sbjct: 407 CPVKIQIPKRRCFKCW 422 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 425 PLLGKYVVKITILLLFDINKNITLILNKH 339 PLLGKY++ IL+ I + ++LN H Sbjct: 304 PLLGKYLIFAMILVSISICVTV-VVLNVH 331 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 24.2 bits (50), Expect = 3.2 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -3 Query: 425 PLLGKYVVKITILLLFDINKNITLILNKH 339 PLLGKY++ IL+ I + ++LN H Sbjct: 304 PLLGKYLIFAMILVSISICVTV-VVLNVH 331 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 23.8 bits (49), Expect = 4.3 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 425 PLLGKYVVKITILLLFDINKNITLILNKH 339 PLLGK+V+ IL F I + ++LN H Sbjct: 300 PLLGKFVLFTMILDTFSICVTV-IVLNIH 327 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 549,794 Number of Sequences: 2352 Number of extensions: 9390 Number of successful extensions: 20 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -