BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0316.Seq (459 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_14608| Best HMM Match : AhpC-TSA (HMM E-Value=0) 100 7e-22 SB_22073| Best HMM Match : No HMM Matches (HMM E-Value=.) 92 2e-19 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 43 1e-04 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 43 1e-04 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 43 1e-04 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 43 1e-04 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 43 1e-04 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 43 1e-04 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 43 1e-04 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_11036| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 4e-04 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 6e-04 SB_27671| Best HMM Match : UCR_TM (HMM E-Value=0.82) 40 7e-04 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 7e-04 SB_28611| Best HMM Match : MAM (HMM E-Value=4.4e-22) 40 7e-04 SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) 40 0.001 SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) 40 0.001 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_21862| Best HMM Match : ABC_membrane_2 (HMM E-Value=1) 39 0.002 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_15196| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_12355| Best HMM Match : IncA (HMM E-Value=2) 38 0.003 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_53858| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 38 0.003 SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_48361| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_41536| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.003 SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) 38 0.004 SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) 38 0.004 SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.004 SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) 38 0.004 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.004 SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.004 SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.004 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) 38 0.004 SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) 38 0.004 SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) 38 0.004 SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) 38 0.004 SB_29458| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 38 0.004 SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_39376| Best HMM Match : Alpha-amylase_C (HMM E-Value=0.49) 38 0.005 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_53755| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_50474| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_48851| Best HMM Match : zf-C2H2 (HMM E-Value=3.2e-13) 38 0.005 SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_26020| Best HMM Match : UCR_TM (HMM E-Value=6.4) 38 0.005 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 38 0.005 SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) 37 0.007 SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.007 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 37 0.009 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) 37 0.009 SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) 37 0.009 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_38866| Best HMM Match : HHH (HMM E-Value=0.00018) 37 0.009 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_16265| Best HMM Match : Vicilin_N (HMM E-Value=3.3) 37 0.009 SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_9678| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 37 0.009 SB_4964| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) 37 0.009 SB_54051| Best HMM Match : WSC (HMM E-Value=1.8e-08) 37 0.009 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_48920| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) 37 0.009 SB_40506| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_34485| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_34258| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) 37 0.009 SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_30561| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_28685| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) 37 0.009 SB_21460| Best HMM Match : GAS2 (HMM E-Value=0.0008) 37 0.009 SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) 37 0.009 SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_19333| Best HMM Match : RNase_P_Rpp14 (HMM E-Value=0.042) 37 0.009 SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) 37 0.009 SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_829| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_279| Best HMM Match : rve (HMM E-Value=3.2) 37 0.009 SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.021 SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) 36 0.021 SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.028 SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.028 SB_56357| Best HMM Match : Ank (HMM E-Value=1.2e-06) 35 0.028 SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) 35 0.028 SB_24639| Best HMM Match : OEP (HMM E-Value=1.1) 35 0.028 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 35 0.028 SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.028 SB_36063| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.037 SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.037 SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) 34 0.065 SB_27155| Best HMM Match : Dynein_heavy (HMM E-Value=1.1e-09) 34 0.065 SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.065 SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) 34 0.065 SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.065 SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) 33 0.086 SB_51382| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.086 SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9) 33 0.086 SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.086 SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) 33 0.086 SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_39086| Best HMM Match : Herpes_capsid (HMM E-Value=2.7) 33 0.11 SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) 33 0.11 SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_44598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 33 0.11 SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) 33 0.11 SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) 33 0.11 SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) 33 0.15 SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) 33 0.15 SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) 33 0.15 SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) 32 0.20 SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.20 SB_45222| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.20 SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.20 SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.20 SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) 32 0.20 SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.20 SB_17552| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.20 SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_18864| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.26 SB_16764| Best HMM Match : ACPS (HMM E-Value=4.4) 32 0.26 SB_10325| Best HMM Match : ubiquitin (HMM E-Value=3.4e-05) 32 0.26 SB_44994| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_41059| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 31 0.35 SB_36461| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_31947| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_31084| Best HMM Match : Collagen (HMM E-Value=9.8) 31 0.35 SB_26141| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_16927| Best HMM Match : bZIP_1 (HMM E-Value=9.8) 31 0.35 SB_4164| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_3614| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_54335| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_39336| Best HMM Match : Kinesin (HMM E-Value=0) 31 0.35 SB_36672| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_36066| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_11195| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.35 SB_53012| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_33167| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_23148| Best HMM Match : DUF1491 (HMM E-Value=9.3) 31 0.46 SB_21395| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_19176| Best HMM Match : YGGT (HMM E-Value=1.1) 31 0.46 SB_56072| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_43062| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_40658| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_39352| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_38298| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_35393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_29161| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_24609| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_15218| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_9135| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.46 SB_5051| Best HMM Match : DUF1193 (HMM E-Value=0.88) 31 0.46 SB_58947| Best HMM Match : Helicase_C (HMM E-Value=0.058) 31 0.61 SB_58676| Best HMM Match : FUN14 (HMM E-Value=0.16) 31 0.61 SB_58459| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_56445| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_55949| Best HMM Match : FLYWCH (HMM E-Value=0.16) 31 0.61 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_51674| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_51455| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_50584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_50510| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_45733| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_45470| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_39953| Best HMM Match : Ank (HMM E-Value=1.8e-19) 31 0.61 SB_38748| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_38234| Best HMM Match : RuvB_C (HMM E-Value=7) 31 0.61 SB_38187| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_36183| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_36178| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_34721| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_33901| Best HMM Match : RVT_1 (HMM E-Value=5.5e-30) 31 0.61 SB_29872| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_29238| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_26847| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_26370| Best HMM Match : Drf_FH1 (HMM E-Value=5.2) 31 0.61 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 31 0.61 SB_25318| Best HMM Match : fn3 (HMM E-Value=2e-15) 31 0.61 SB_23492| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_23266| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_21736| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_20654| Best HMM Match : Helicase_C (HMM E-Value=2.3e-21) 31 0.61 SB_20088| Best HMM Match : OAD_gamma (HMM E-Value=3) 31 0.61 SB_19756| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_18977| Best HMM Match : DUF834 (HMM E-Value=8.8) 31 0.61 SB_17152| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_16821| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_16601| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_16094| Best HMM Match : 7tm_1 (HMM E-Value=0.16) 31 0.61 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 31 0.61 SB_13723| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_12438| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_10646| Best HMM Match : GPW_gp25 (HMM E-Value=5.8) 31 0.61 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 31 0.61 SB_9574| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_8947| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_7088| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_4959| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_4398| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_1174| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_630| Best HMM Match : Pox_F17 (HMM E-Value=2.4) 31 0.61 SB_56924| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_52635| Best HMM Match : THF_DHG_CYH_C (HMM E-Value=1.3) 31 0.61 SB_51037| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_49768| Best HMM Match : MORN (HMM E-Value=7.4) 31 0.61 SB_49463| Best HMM Match : RVT_1 (HMM E-Value=2.7) 31 0.61 SB_48664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_47765| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_47738| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_45526| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_44008| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_43854| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.7) 31 0.61 SB_43776| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_42773| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_42727| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_41932| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_41019| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_40573| Best HMM Match : RRM_1 (HMM E-Value=1.8e-39) 31 0.61 SB_40404| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_39081| Best HMM Match : Pertussis_S2S3 (HMM E-Value=9.8) 31 0.61 SB_38627| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_37805| Best HMM Match : DoxA (HMM E-Value=1.7) 31 0.61 SB_35778| Best HMM Match : Dickkopf_N (HMM E-Value=2.4) 31 0.61 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 31 0.61 SB_34337| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_34031| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_31524| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_31275| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_30687| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_28573| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_26894| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_21132| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_20517| Best HMM Match : Nuclease_act (HMM E-Value=1.4) 31 0.61 SB_20344| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_20082| Best HMM Match : DUF378 (HMM E-Value=4.1) 31 0.61 SB_18544| Best HMM Match : 7tm_1 (HMM E-Value=0.00082) 31 0.61 SB_17466| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_16112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_14808| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_11965| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_11390| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_10723| Best HMM Match : Chromo (HMM E-Value=0.031) 31 0.61 SB_9384| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_8821| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_6860| Best HMM Match : zf-C3HC4 (HMM E-Value=0.14) 31 0.61 SB_6705| Best HMM Match : SAA (HMM E-Value=8.3) 31 0.61 SB_6458| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_6326| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_4934| Best HMM Match : NAD_binding_2 (HMM E-Value=4.8) 31 0.61 SB_2599| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_742| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.61 SB_31001| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.80 SB_29441| Best HMM Match : MFS_1 (HMM E-Value=1.6e-12) 30 1.1 SB_3948| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.4 SB_58889| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_18568| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.5e-22) 29 1.8 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_27070| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_16131| Best HMM Match : RhoGEF (HMM E-Value=2e-05) 27 5.6 SB_15247| Best HMM Match : Hormone_5 (HMM E-Value=0.98) 27 5.6 SB_55930| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_36665| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_28258| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.5 SB_58802| Best HMM Match : Gag_spuma (HMM E-Value=2.7) 27 9.9 >SB_14608| Best HMM Match : AhpC-TSA (HMM E-Value=0) Length = 265 Score = 100 bits (239), Expect = 7e-22 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = -2 Query: 260 QGKYVVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGCEVLGASTDSHFTHLAWINTP 90 +GKYVVLFFYPLDFTFVCPTEIIAFS++ DEF+ I CEV+ S DS ++HLAW N P Sbjct: 80 KGKYVVLFFYPLDFTFVCPTEIIAFSDRVDEFKAINCEVIACSVDSEYSHLAWTNVP 136 Score = 42.3 bits (95), Expect = 2e-04 Identities = 24/51 (47%), Positives = 31/51 (60%), Gaps = 4/51 (7%) Frame = -3 Query: 394 AXAFVYYSKVFSFNKMPLQMT---KPAPQFKATAV-VNGEFKDISLSDYKG 254 A AF ++ SF++ + T KPAP F TAV +GEF D+ LSDYKG Sbjct: 31 APAFHLAKRMMSFSRADMSKTAIQKPAPAFSGTAVNKHGEFIDLKLSDYKG 81 >SB_22073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 91.9 bits (218), Expect = 2e-19 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = -2 Query: 260 QGKYVVLFFYPLDFTFVCPTEIIAFSEKADEFRKIGCEVLGASTDSHFTHLAW 102 +GKY+V FFYPLDFTFVCPTEIIAFS++ +EFR I EV+G S DS FTHLAW Sbjct: 82 EGKYLVFFFYPLDFTFVCPTEIIAFSDRIEEFRAINTEVVGCSVDSVFTHLAW 134 Score = 46.4 bits (105), Expect = 1e-05 Identities = 19/32 (59%), Positives = 27/32 (84%) Frame = -3 Query: 340 QMTKPAPQFKATAVVNGEFKDISLSDYKGNML 245 Q++KPAP ++ TAVVNGEFK++ LSD++G L Sbjct: 55 QISKPAPFWEGTAVVNGEFKELKLSDFEGKYL 86 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.2 bits (97), Expect = 1e-04 Identities = 24/51 (47%), Positives = 28/51 (54%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFNKMPLQMTKPAPQFKATAVV 296 GTGPPLEVDGIDKLDIEF S + + LQ + + AVV Sbjct: 18 GTGPPLEVDGIDKLDIEFVQPGGSTSSRAAATAVELQFALYESYYNSLAVV 68 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.2 bits (97), Expect = 1e-04 Identities = 24/51 (47%), Positives = 28/51 (54%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFNKMPLQMTKPAPQFKATAVV 296 GTGPPLEVDGIDKLDIEF S + + LQ + + AVV Sbjct: 18 GTGPPLEVDGIDKLDIEFVEPGGSTSSRAAATAVELQFALYESYYNSLAVV 68 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.2 bits (97), Expect = 1e-04 Identities = 24/51 (47%), Positives = 28/51 (54%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFNKMPLQMTKPAPQFKATAVV 296 GTGPPLEVDGIDKLDIEF S + + LQ + + AVV Sbjct: 18 GTGPPLEVDGIDKLDIEFVDPGGSTSSRAAATAVELQFALYESYYNSLAVV 68 >SB_49577| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 43.2 bits (97), Expect = 1e-04 Identities = 22/49 (44%), Positives = 31/49 (63%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFNKMPLQMTKPAPQFKATA 302 GTGPPLEVDGIDKLD +YSK++ PL + +P P++ + + Sbjct: 18 GTGPPLEVDGIDKLD------SCHYSKLYVSPGDPLVLERPPPRWSSNS 60 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 43.2 bits (97), Expect = 1e-04 Identities = 24/51 (47%), Positives = 28/51 (54%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFNKMPLQMTKPAPQFKATAVV 296 GTGPPLEVDGIDKLDIEF S + + LQ + + AVV Sbjct: 18 GTGPPLEVDGIDKLDIEFLQPGGSTSSRAAATAVELQFALYESDYNSLAVV 68 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 5 GTGPPLEVDGIDKLDIEF 22 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 23 GTGPPLEVDGIDKLDIEF 40 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 48 GTGPPLEVDGIDKLDIEF 65 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 20 GTGPPLEVDGIDKLDIEF 37 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 5 GTGPPLEVDGIDKLDIEF 22 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) Length = 163 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 23 GTGPPLEVDGIDKLDIEF 40 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 7 GTGPPLEVDGIDKLDIEF 24 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 56 GTGPPLEVDGIDKLDIEF 73 >SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 42.7 bits (96), Expect = 1e-04 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLDIEF Sbjct: 18 GTGPPLEVDGIDKLDIEF 35 >SB_11036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 41.9 bits (94), Expect = 2e-04 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 1/56 (1%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSF-NKMPLQMTKPAPQFKATAVVNGEF 284 GTGPPLEVDGIDKLD++ F + S+ N + +P+ Q ++ +NGE+ Sbjct: 18 GTGPPLEVDGIDKLDVDDYRQFPAHPPFASWRNSEEARTDRPSQQLRS---LNGEW 70 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 41.5 bits (93), Expect = 3e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLE+DGIDKLDIEF Sbjct: 5 GTGPPLELDGIDKLDIEF 22 >SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.1 bits (92), Expect = 4e-04 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 G+GPPLEVDGIDKLDIEF Sbjct: 18 GSGPPLEVDGIDKLDIEF 35 >SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 40.7 bits (91), Expect = 6e-04 Identities = 19/27 (70%), Positives = 22/27 (81%), Gaps = 1/27 (3%) Frame = +2 Query: 374 IIDEXG-REFDIKLIDTVDLEGGPGTQ 451 ++D G +EFDIKLIDTVDLEGGP Q Sbjct: 60 LVDPPGLQEFDIKLIDTVDLEGGPAYQ 86 >SB_27671| Best HMM Match : UCR_TM (HMM E-Value=0.82) Length = 151 Score = 40.3 bits (90), Expect = 7e-04 Identities = 19/29 (65%), Positives = 20/29 (68%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVF 362 GTGPPLEVDGIDKLD+ A Y VF Sbjct: 18 GTGPPLEVDGIDKLDVVTAVRNFRYLDVF 46 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 40.3 bits (90), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 G GPPLEVDGIDKLDIEF Sbjct: 18 GPGPPLEVDGIDKLDIEF 35 >SB_28611| Best HMM Match : MAM (HMM E-Value=4.4e-22) Length = 229 Score = 40.3 bits (90), Expect = 7e-04 Identities = 18/30 (60%), Positives = 22/30 (73%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFS 359 GTGPPLEVDGIDKLD+ A ++Y + S Sbjct: 5 GTGPPLEVDGIDKLDLWRVFADLWYRRPLS 34 >SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 39.9 bits (89), Expect = 0.001 Identities = 15/18 (83%), Positives = 18/18 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLD+++ Sbjct: 18 GTGPPLEVDGIDKLDVQY 35 >SB_42996| Best HMM Match : Neur_chan_memb (HMM E-Value=0.14) Length = 190 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/39 (51%), Positives = 24/39 (61%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFNKMPLQMT 332 GTGPPLEVDGIDKLDI +Y S ++ L +T Sbjct: 18 GTGPPLEVDGIDKLDILALTLLSFYLPSESGERLTLVIT 56 >SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) Length = 137 Score = 39.9 bits (89), Expect = 0.001 Identities = 20/39 (51%), Positives = 26/39 (66%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFNKMPLQMT 332 GTGPPLEVDGIDKLD+ A + ++ S PL++T Sbjct: 18 GTGPPLEVDGIDKLDVTLKTAKGHTNRPIS-KLYPLEIT 55 >SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/32 (59%), Positives = 20/32 (62%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFN 353 GTGPPLEVDGIDKLDI + S S N Sbjct: 18 GTGPPLEVDGIDKLDIIIIIIIISSSSSSSIN 49 >SB_43137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 39.5 bits (88), Expect = 0.001 Identities = 21/49 (42%), Positives = 29/49 (59%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFNKMPLQMTKPAPQFKATA 302 GTGPPLEVDGIDKLD A + +F PL + +P P++ + + Sbjct: 18 GTGPPLEVDGIDKLDSGEKEAVESFG-LFVSPGDPLVLERPPPRWSSNS 65 >SB_38487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 39.5 bits (88), Expect = 0.001 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 5/54 (9%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFNKM-----PLQMTKPAPQFKATA 302 GTGPPLEVDGIDKLD++ +KV S + PL + +P P++ + + Sbjct: 18 GTGPPLEVDGIDKLDLDI-DVIRCLNKVQSLSNSCSPGDPLVLERPPPRWSSNS 70 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 447 VPGPPSRSTVSISLISNS 394 VPGPPSRSTVSISLISNS Sbjct: 20 VPGPPSRSTVSISLISNS 37 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 447 VPGPPSRSTVSISLISNS 394 VPGPPSRSTVSISLISNS Sbjct: 20 VPGPPSRSTVSISLISNS 37 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 447 VPGPPSRSTVSISLISNS 394 VPGPPSRSTVSISLISNS Sbjct: 20 VPGPPSRSTVSISLISNS 37 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 447 VPGPPSRSTVSISLISNS 394 VPGPPSRSTVSISLISNS Sbjct: 20 VPGPPSRSTVSISLISNS 37 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 447 VPGPPSRSTVSISLISNS 394 VPGPPSRSTVSISLISNS Sbjct: 20 VPGPPSRSTVSISLISNS 37 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 447 VPGPPSRSTVSISLISNS 394 VPGPPSRSTVSISLISNS Sbjct: 20 VPGPPSRSTVSISLISNS 37 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 447 VPGPPSRSTVSISLISNS 394 VPGPPSRSTVSISLISNS Sbjct: 20 VPGPPSRSTVSISLISNS 37 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 39.1 bits (87), Expect = 0.002 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 447 VPGPPSRSTVSISLISNS 394 VPGPPSRSTVSISLISNS Sbjct: 18 VPGPPSRSTVSISLISNS 35 >SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIE 398 GTGPPLEVDGIDKLDI+ Sbjct: 18 GTGPPLEVDGIDKLDID 34 >SB_21862| Best HMM Match : ABC_membrane_2 (HMM E-Value=1) Length = 140 Score = 38.7 bits (86), Expect = 0.002 Identities = 18/28 (64%), Positives = 20/28 (71%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKV 365 GTGPPLEVDGIDKLD A + SK+ Sbjct: 58 GTGPPLEVDGIDKLDACLADLYSNVSKM 85 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/22 (77%), Positives = 17/22 (77%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAF 383 GTGPPLEVDGIDKLDI F Sbjct: 18 GTGPPLEVDGIDKLDIAVIRLF 39 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIE 398 GTGPPLEVDGIDKLD++ Sbjct: 18 GTGPPLEVDGIDKLDVD 34 >SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 38.7 bits (86), Expect = 0.002 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIE 398 GTGPPLEVDGIDKLD++ Sbjct: 18 GTGPPLEVDGIDKLDVD 34 >SB_7324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 38.7 bits (86), Expect = 0.002 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXA 386 GTGPPLEVDGIDKLD F A Sbjct: 18 GTGPPLEVDGIDKLDAVFLTA 38 >SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 38.3 bits (85), Expect = 0.003 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 4/52 (7%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYY--SKV--FSFNKMPLQMTKPAPQFKAT 305 GTGPPLEVDGIDKLD A ++ SK+ + F P+ + A +F+A+ Sbjct: 18 GTGPPLEVDGIDKLDGPSAAVVLFRQPSKMDGYIFRFSPVIRSMKANEFRAS 69 >SB_15196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 38.3 bits (85), Expect = 0.003 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIE 398 GTGPPLEVDGIDKLD++ Sbjct: 18 GTGPPLEVDGIDKLDVK 34 >SB_12355| Best HMM Match : IncA (HMM E-Value=2) Length = 225 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLDI Sbjct: 18 GTGPPLEVDGIDKLDI 33 >SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/19 (89%), Positives = 17/19 (89%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFA 392 GTGPPLEVDGIDKLD E A Sbjct: 18 GTGPPLEVDGIDKLDPEAA 36 >SB_4943| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 38.3 bits (85), Expect = 0.003 Identities = 17/22 (77%), Positives = 18/22 (81%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAF 383 GTGPPLEVDGIDKLD + AF Sbjct: 18 GTGPPLEVDGIDKLDPQRRVAF 39 >SB_53858| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 38.3 bits (85), Expect = 0.003 Identities = 18/27 (66%), Positives = 19/27 (70%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSK 368 GTGPPLEVDGIDKLD+ A V K Sbjct: 18 GTGPPLEVDGIDKLDLLLTNAPVMKKK 44 >SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) Length = 216 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 442 GPPLEVDGIDKLDIEF 395 GPPLEVDGIDKLDIEF Sbjct: 21 GPPLEVDGIDKLDIEF 36 >SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIE 398 GTGPPLEVDGIDKLD E Sbjct: 18 GTGPPLEVDGIDKLDAE 34 >SB_48361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/23 (69%), Positives = 17/23 (73%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFV 380 GTGPPLEVDGIDKLD+ V Sbjct: 18 GTGPPLEVDGIDKLDVRTCKTIV 40 >SB_41536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLDI Sbjct: 5 GTGPPLEVDGIDKLDI 20 >SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 38.3 bits (85), Expect = 0.003 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -3 Query: 442 GPPLEVDGIDKLDIEF 395 GPPLEVDGIDKLDIEF Sbjct: 21 GPPLEVDGIDKLDIEF 36 >SB_10710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 38.3 bits (85), Expect = 0.003 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIE 398 GTGPPLEVDGIDKLD++ Sbjct: 18 GTGPPLEVDGIDKLDVK 34 >SB_58623| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) Length = 1065 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 77 GTGPPLEVDGIDKLDV 92 >SB_49074| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_39984| Best HMM Match : RadC (HMM E-Value=2.2) Length = 229 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_24893| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 92 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_3784| Best HMM Match : ICAM_N (HMM E-Value=4.1) Length = 142 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 116 QEFDIKLIDTVDLEGGP 132 >SB_54353| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 141 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_50800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDV 33 >SB_49985| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 127 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDV 33 >SB_49381| Best HMM Match : RuvB_C (HMM E-Value=8.2) Length = 119 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_44811| Best HMM Match : Toxin_33 (HMM E-Value=8.1) Length = 142 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) Length = 197 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDV 33 >SB_34092| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 142 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_29458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDV 33 >SB_22691| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 37.9 bits (84), Expect = 0.004 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +EFDIKLIDTVDLEGGP Sbjct: 21 QEFDIKLIDTVDLEGGP 37 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 37.9 bits (84), Expect = 0.004 Identities = 17/21 (80%), Positives = 17/21 (80%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXA 386 GTGPPLEVDGIDKLD E A Sbjct: 18 GTGPPLEVDGIDKLDPELHPA 38 >SB_15776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 19 GTGPPLEVDGIDKLDV 34 >SB_5823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2324 Score = 37.9 bits (84), Expect = 0.004 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 1883 GTGPPLEVDGIDKLDV 1898 >SB_39376| Best HMM Match : Alpha-amylase_C (HMM E-Value=0.49) Length = 679 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 5 GTGPPLEVDGIDKLDL 20 >SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDL 33 >SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 37.5 bits (83), Expect = 0.005 Identities = 19/29 (65%), Positives = 21/29 (72%), Gaps = 2/29 (6%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF--AXAFVYYSK 368 GTGPPLEVDGIDKLD + A + YY K Sbjct: 18 GTGPPLEVDGIDKLDGKTLQAISVAYYYK 46 >SB_22464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDL 33 >SB_21004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIE 398 GTGPPLEVDGIDKLD E Sbjct: 18 GTGPPLEVDGIDKLDPE 34 >SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEF 395 GTGPPLEVDGIDKLD + Sbjct: 18 GTGPPLEVDGIDKLDTRY 35 >SB_53755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDL 33 >SB_50474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIE 398 GTGPPLEVDGIDKLD E Sbjct: 18 GTGPPLEVDGIDKLDEE 34 >SB_48851| Best HMM Match : zf-C2H2 (HMM E-Value=3.2e-13) Length = 169 Score = 37.5 bits (83), Expect = 0.005 Identities = 17/28 (60%), Positives = 22/28 (78%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKV 365 GTGPPLEVDGIDKLD + +Y+S++ Sbjct: 5 GTGPPLEVDGIDKLDDKCG---IYFSQI 29 >SB_48730| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDL 33 >SB_26020| Best HMM Match : UCR_TM (HMM E-Value=6.4) Length = 122 Score = 37.5 bits (83), Expect = 0.005 Identities = 19/33 (57%), Positives = 21/33 (63%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFVYYSKVFSFNK 350 GTGPPLEVDGIDKLD + AF K + K Sbjct: 18 GTGPPLEVDGIDKLDAQ-CQAFTEEYKALATGK 49 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDL 33 >SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 37.5 bits (83), Expect = 0.005 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDL 33 >SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) Length = 317 Score = 37.5 bits (83), Expect = 0.005 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGPGT 448 DIKLIDTVDLEGGPGT Sbjct: 297 DIKLIDTVDLEGGPGT 312 >SB_55180| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 37.1 bits (82), Expect = 0.007 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = +2 Query: 377 IDEXGREFDIKLIDTVDLEGGP 442 ++ +++DIKLIDTVDLEGGP Sbjct: 29 VEHLNKKYDIKLIDTVDLEGGP 50 >SB_54116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 37.1 bits (82), Expect = 0.007 Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 3/48 (6%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXAFV---YYSKVFSFNKMPLQMTKPAPQF 314 GTGPPLEVDGIDKLD A V Y ++ F + P P P F Sbjct: 18 GTGPPLEVDGIDKLDAGLMAAEVLSQYDYQIDVFEQKP--SAAPHPPF 63 >SB_23208| Best HMM Match : X_fast-SP_rel (HMM E-Value=6.6) Length = 195 Score = 37.1 bits (82), Expect = 0.007 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPLEVDGIDKLD+ Sbjct: 18 GTGPPLEVDGIDKLDM 33 >SB_15725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 220 Score = 37.1 bits (82), Expect = 0.007 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIE 398 GTGPPLEVDGIDKLD + Sbjct: 18 GTGPPLEVDGIDKLDAQ 34 >SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 234 Score = 37.1 bits (82), Expect = 0.007 Identities = 16/21 (76%), Positives = 17/21 (80%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDIEFAXA 386 GTGPPLEVDGIDKLD + A Sbjct: 18 GTGPPLEVDGIDKLDEDLQGA 38 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_52828| Best HMM Match : Apidaecin (HMM E-Value=4.5) Length = 129 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_49901| Best HMM Match : DoxX (HMM E-Value=6.2) Length = 143 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_38866| Best HMM Match : HHH (HMM E-Value=0.00018) Length = 120 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 5 GTGPPLEVDGIDKLD 19 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_26886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6489 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 3435 GTGPPLEVDGIDKLD 3449 >SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_16265| Best HMM Match : Vicilin_N (HMM E-Value=3.3) Length = 199 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 5 GTGPPLEVDGIDKLD 19 >SB_13592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_12763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_9678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) Length = 190 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_4964| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 5 GTGPPLEVDGIDKLD 19 >SB_54638| Best HMM Match : Cache (HMM E-Value=0.0031) Length = 598 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 89 GTGPPLEVDGIDKLD 103 >SB_54051| Best HMM Match : WSC (HMM E-Value=1.8e-08) Length = 93 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_48920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_48297| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_46116| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_43466| Best HMM Match : DEAD (HMM E-Value=1.8) Length = 210 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_40506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 5 GTGPPLEVDGIDKLD 19 >SB_34485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_34258| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_32876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_32543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_31452| Best HMM Match : Telo_bind (HMM E-Value=3.2) Length = 200 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_30732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_30561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 53 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 5 GTGPPLEVDGIDKLD 19 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_29561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 5 GTGPPLEVDGIDKLD 19 >SB_28685| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 5 GTGPPLEVDGIDKLD 19 >SB_28381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_26132| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_21904| Best HMM Match : Vinculin (HMM E-Value=0) Length = 999 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 807 GTGPPLEVDGIDKLD 821 >SB_21460| Best HMM Match : GAS2 (HMM E-Value=0.0008) Length = 123 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_20859| Best HMM Match : ADK_lid (HMM E-Value=3.3) Length = 212 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_19388| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 227 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_19333| Best HMM Match : RNase_P_Rpp14 (HMM E-Value=0.042) Length = 168 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_17848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_7704| Best HMM Match : DivIVA (HMM E-Value=9.6) Length = 163 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 5 GTGPPLEVDGIDKLD 19 >SB_6512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 18 GTGPPLEVDGIDKLD 32 >SB_279| Best HMM Match : rve (HMM E-Value=3.2) Length = 188 Score = 36.7 bits (81), Expect = 0.009 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKLD Sbjct: 5 GTGPPLEVDGIDKLD 19 >SB_42734| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 35.5 bits (78), Expect = 0.021 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = +2 Query: 377 IDEXGREFDIKLIDTVDLEGGP 442 I++ G + IKLIDTVDLEGGP Sbjct: 72 IEQRGTSYIIKLIDTVDLEGGP 93 >SB_48370| Best HMM Match : P19Arf_N (HMM E-Value=6.9) Length = 158 Score = 35.5 bits (78), Expect = 0.021 Identities = 21/49 (42%), Positives = 25/49 (51%) Frame = -3 Query: 442 GPPLEVDGIDKLDIEFAXAFVYYSKVFSFNKMPLQMTKPAPQFKATAVV 296 G PLEVDGIDKLDIEF S + + LQ + + AVV Sbjct: 22 GAPLEVDGIDKLDIEFVEPGGSTSSRAAATAVELQFALYESYYNSLAVV 70 >SB_15111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +2 Query: 392 REFDIKLIDTVDLEGG 439 +EFDIKLIDTVDLEGG Sbjct: 21 QEFDIKLIDTVDLEGG 36 >SB_7053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = +2 Query: 374 IIDEXGREFDIKLIDTVDLEGGP 442 ++ GR+ IKLIDTVDLEGGP Sbjct: 16 VVKAQGRDVLIKLIDTVDLEGGP 38 >SB_56357| Best HMM Match : Ank (HMM E-Value=1.2e-06) Length = 73 Score = 35.1 bits (77), Expect = 0.028 Identities = 28/69 (40%), Positives = 35/69 (50%) Frame = +2 Query: 236 RTAQHISLVVRQRNVLELSVDDGRGLELGSGFGHLQRHLVETKDF*IIDEXGREFDIKLI 415 RTA H S+ V Q ++ L +D G + LG L ++D DIKLI Sbjct: 21 RTALHDSITVGQIEIVRLLLDKGADVNLGYDPDKL-----------MMD------DIKLI 63 Query: 416 DTVDLEGGP 442 DTVDLEGGP Sbjct: 64 DTVDLEGGP 72 >SB_40683| Best HMM Match : VWD (HMM E-Value=2.4e-05) Length = 2200 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 404 IKLIDTVDLEGGPGT 448 IKLIDTVDLEGGPGT Sbjct: 484 IKLIDTVDLEGGPGT 498 >SB_24639| Best HMM Match : OEP (HMM E-Value=1.1) Length = 197 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = +2 Query: 404 IKLIDTVDLEGGPGT 448 IKLIDTVDLEGGPGT Sbjct: 178 IKLIDTVDLEGGPGT 192 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 35.1 bits (77), Expect = 0.028 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = -3 Query: 448 GTGPPLEVDGIDKLD 404 GTGPPLEVDGIDKL+ Sbjct: 406 GTGPPLEVDGIDKLE 420 >SB_3301| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 35.1 bits (77), Expect = 0.028 Identities = 15/17 (88%), Positives = 16/17 (94%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 R+ DIKLIDTVDLEGGP Sbjct: 9 RKVDIKLIDTVDLEGGP 25 >SB_36063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 42 Score = 34.7 bits (76), Expect = 0.037 Identities = 17/35 (48%), Positives = 21/35 (60%) Frame = +2 Query: 338 LQRHLVETKDF*IIDEXGREFDIKLIDTVDLEGGP 442 LQ + +DF + + IKLIDTVDLEGGP Sbjct: 7 LQTLVCTLEDFCVCGTDSNDLFIKLIDTVDLEGGP 41 >SB_8047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 34.7 bits (76), Expect = 0.037 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = +2 Query: 389 GREFDIKLIDTVDLEGGP 442 GR+ IKLIDTVDLEGGP Sbjct: 53 GRKVKIKLIDTVDLEGGP 70 >SB_3825| Best HMM Match : Pheromone (HMM E-Value=3.3) Length = 189 Score = 33.9 bits (74), Expect = 0.065 Identities = 17/23 (73%), Positives = 18/23 (78%), Gaps = 1/23 (4%) Frame = +2 Query: 377 IDEXGRE-FDIKLIDTVDLEGGP 442 ID G+E IKLIDTVDLEGGP Sbjct: 62 IDSHGKENATIKLIDTVDLEGGP 84 >SB_27155| Best HMM Match : Dynein_heavy (HMM E-Value=1.1e-09) Length = 1248 Score = 33.9 bits (74), Expect = 0.065 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -1 Query: 447 VPGPPSRSTVSISLISNSRPXSSI 376 VPGPPSRSTVSISLI + S+ Sbjct: 1080 VPGPPSRSTVSISLILDCNASRSL 1103 >SB_24394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 33.9 bits (74), Expect = 0.065 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +2 Query: 377 IDEXGREFDIKLIDTVDLEGGP 442 +D R+ IKLIDTVDLEGGP Sbjct: 161 LDTLKRQSHIKLIDTVDLEGGP 182 >SB_16421| Best HMM Match : HD-ZIP_N (HMM E-Value=7.6) Length = 213 Score = 33.9 bits (74), Expect = 0.065 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 395 EFDIKLIDTVDLEGGP 442 +F IKLIDTVDLEGGP Sbjct: 93 DFSIKLIDTVDLEGGP 108 >SB_8089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.9 bits (74), Expect = 0.065 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 + F+IKLIDTVDLEGGP Sbjct: 4 QRFNIKLIDTVDLEGGP 20 >SB_54894| Best HMM Match : RuvB_C (HMM E-Value=2.3) Length = 148 Score = 33.5 bits (73), Expect = 0.086 Identities = 17/32 (53%), Positives = 19/32 (59%) Frame = +2 Query: 347 HLVETKDF*IIDEXGREFDIKLIDTVDLEGGP 442 HL ++ I E IKLIDTVDLEGGP Sbjct: 12 HLDSLEELYISHNGIEEIKIKLIDTVDLEGGP 43 >SB_51382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 33.5 bits (73), Expect = 0.086 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 395 EFDIKLIDTVDLEGGP 442 + DIKLIDTVDLEGGP Sbjct: 200 KMDIKLIDTVDLEGGP 215 >SB_55061| Best HMM Match : Defensin_beta (HMM E-Value=6.9) Length = 350 Score = 33.5 bits (73), Expect = 0.086 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -1 Query: 447 VPGPPSRSTVSISLI 403 VPGPPSRSTVSISLI Sbjct: 6 VPGPPSRSTVSISLI 20 >SB_49124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.5 bits (73), Expect = 0.086 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 R F IKLIDTVDLEGGP Sbjct: 32 RGFRIKLIDTVDLEGGP 48 >SB_16384| Best HMM Match : Ribosomal_L15e (HMM E-Value=1.1) Length = 171 Score = 33.5 bits (73), Expect = 0.086 Identities = 14/15 (93%), Positives = 15/15 (100%) Frame = +2 Query: 398 FDIKLIDTVDLEGGP 442 F+IKLIDTVDLEGGP Sbjct: 52 FNIKLIDTVDLEGGP 66 >SB_56553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 426 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 404 IKLIDTVDLEGGPG 445 IKLIDTVDLEGGPG Sbjct: 40 IKLIDTVDLEGGPG 53 >SB_55896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 73 DIKLIDTVDLEGGP 86 >SB_47856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 95 DIKLIDTVDLEGGP 108 >SB_40612| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 40 DIKLIDTVDLEGGP 53 >SB_39086| Best HMM Match : Herpes_capsid (HMM E-Value=2.7) Length = 166 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 152 DIKLIDTVDLEGGP 165 >SB_11969| Best HMM Match : Papilloma_E5 (HMM E-Value=4.6) Length = 190 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 398 FDIKLIDTVDLEGGP 442 F IKLIDTVDLEGGP Sbjct: 71 FSIKLIDTVDLEGGP 85 >SB_8359| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 27 DIKLIDTVDLEGGP 40 >SB_59114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 20 DIKLIDTVDLEGGP 33 >SB_47238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 5 DIKLIDTVDLEGGP 18 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 87 DIKLIDTVDLEGGP 100 >SB_44598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 48 DIKLIDTVDLEGGP 61 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 77 DIKLIDTVDLEGGP 90 >SB_32541| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 21 DIKLIDTVDLEGGP 34 >SB_29812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 398 FDIKLIDTVDLEGGP 442 F IKLIDTVDLEGGP Sbjct: 4 FQIKLIDTVDLEGGP 18 >SB_21601| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 370 Score = 33.1 bits (72), Expect = 0.11 Identities = 18/42 (42%), Positives = 24/42 (57%) Frame = +2 Query: 317 LGSGFGHLQRHLVETKDF*IIDEXGREFDIKLIDTVDLEGGP 442 L S + QR ++ K ++ +IKLIDTVDLEGGP Sbjct: 224 LSSLYAEQQRSRLDPKTNTNFEKHNGVVNIKLIDTVDLEGGP 265 >SB_6008| Best HMM Match : CPSase_L_D2 (HMM E-Value=0) Length = 866 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 798 DIKLIDTVDLEGGP 811 >SB_4559| Best HMM Match : ICAM_N (HMM E-Value=5.3) Length = 244 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 9 DIKLIDTVDLEGGP 22 >SB_3585| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1117 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 95 DIKLIDTVDLEGGP 108 >SB_3444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.1 bits (72), Expect = 0.11 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 401 DIKLIDTVDLEGGP 442 DIKLIDTVDLEGGP Sbjct: 28 DIKLIDTVDLEGGP 41 >SB_47451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +2 Query: 395 EFDIKLIDTVDLEGGP 442 E IKLIDTVDLEGGP Sbjct: 19 EISIKLIDTVDLEGGP 34 >SB_30841| Best HMM Match : HLH (HMM E-Value=1.5) Length = 189 Score = 32.7 bits (71), Expect = 0.15 Identities = 21/53 (39%), Positives = 25/53 (47%) Frame = +2 Query: 284 ELSVDDGRGLELGSGFGHLQRHLVETKDF*IIDEXGREFDIKLIDTVDLEGGP 442 E D R + + F Q LV +D + IKLIDTVDLEGGP Sbjct: 87 EAKAADERSKKAAAEFARAQAELVSAQDHATAADR-----IKLIDTVDLEGGP 134 >SB_23451| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 398 FDIKLIDTVDLEGGP 442 F IKLIDTVDLEGGP Sbjct: 81 FTIKLIDTVDLEGGP 95 >SB_16697| Best HMM Match : Collagen (HMM E-Value=4.2e-11) Length = 1903 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 398 FDIKLIDTVDLEGGP 442 F IKLIDTVDLEGGP Sbjct: 921 FTIKLIDTVDLEGGP 935 >SB_55232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 398 FDIKLIDTVDLEGGP 442 F IKLIDTVDLEGGP Sbjct: 30 FHIKLIDTVDLEGGP 44 >SB_45393| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.088) Length = 488 Score = 32.7 bits (71), Expect = 0.15 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = +2 Query: 389 GREFDIKLIDTVDLEGGP 442 G + IKLIDTVDLEGGP Sbjct: 366 GLHYRIKLIDTVDLEGGP 383 >SB_26864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 32.7 bits (71), Expect = 0.15 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 448 GTGPPLEVDGIDKLDI 401 GTGPPL VDGID LD+ Sbjct: 18 GTGPPLVVDGIDNLDL 33 >SB_58410| Best HMM Match : Umbravirus_LDM (HMM E-Value=5.8) Length = 341 Score = 32.3 bits (70), Expect = 0.20 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +2 Query: 395 EFDIKLIDTVDLEGGP 442 E IKLIDTVDLEGGP Sbjct: 221 EIGIKLIDTVDLEGGP 236 >SB_58084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 32.3 bits (70), Expect = 0.20 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 395 EFDIKLIDTVDLEGGP 442 +F IKLIDTVDLEGGP Sbjct: 41 DFWIKLIDTVDLEGGP 56 >SB_45222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 37 Score = 32.3 bits (70), Expect = 0.20 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 +++ IKLIDTVDLEGGP Sbjct: 20 KDYFIKLIDTVDLEGGP 36 >SB_28553| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 32.3 bits (70), Expect = 0.20 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 383 EXGREFDIKLIDTVDLEGGP 442 E + + IKLIDTVDLEGGP Sbjct: 17 ENDQFYSIKLIDTVDLEGGP 36 >SB_18680| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.3 bits (70), Expect = 0.20 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = +2 Query: 392 REFDIKLIDTVDLEGGP 442 + + IKLIDTVDLEGGP Sbjct: 77 QNYSIKLIDTVDLEGGP 93 >SB_9646| Best HMM Match : MrpF_PhaF (HMM E-Value=9.1) Length = 126 Score = 32.3 bits (70), Expect = 0.20 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 398 FDIKLIDTVDLEGGP 442 F IKLIDTVDLEGGP Sbjct: 111 FRIKLIDTVDLEGGP 125 >SB_40501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 32.3 bits (70), Expect = 0.20 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 395 EFDIKLIDTVDLEGGP 442 E+ IKLIDTVDLEGGP Sbjct: 2 EYLIKLIDTVDLEGGP 17 >SB_17552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 32.3 bits (70), Expect = 0.20 Identities = 14/16 (87%), Positives = 15/16 (93%) Frame = +2 Query: 395 EFDIKLIDTVDLEGGP 442 E +IKLIDTVDLEGGP Sbjct: 52 ECNIKLIDTVDLEGGP 67 >SB_41195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.9 bits (69), Expect = 0.26 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 389 GREFDIKLIDTVDLEGGP 442 GRE IKLIDTVDLEGGP Sbjct: 113 GRE--IKLIDTVDLEGGP 128 >SB_18864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 398 FDIKLIDTVDLEGGP 442 F IKLIDTVDLEGGP Sbjct: 112 FIIKLIDTVDLEGGP 126 >SB_12289| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.9 bits (69), Expect = 0.26 Identities = 18/39 (46%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = +2 Query: 329 FGHLQRHLVETKDF*IIDEXGR-EFDIKLIDTVDLEGGP 442 F + RH+ ID + + IKLIDTVDLEGGP Sbjct: 3 FYNCTRHIERNAAVSSIDNAKKIDTSIKLIDTVDLEGGP 41 >SB_7275| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.9 bits (69), Expect = 0.26 Identities = 17/27 (62%), Positives = 18/27 (66%), Gaps = 4/27 (14%) Frame = +2 Query: 374 IIDEXGREFD----IKLIDTVDLEGGP 442 I+ G E D IKLIDTVDLEGGP Sbjct: 35 ILQGSGNELDNNNTIKLIDTVDLEGGP 61 >SB_2317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 398 FDIKLIDTVDLEGGP 442 F IKLIDTVDLEGGP Sbjct: 80 FIIKLIDTVDLEGGP 94 >SB_35502| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 31.9 bits (69), Expect = 0.26 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = +2 Query: 398 FDIKLIDTVDLEGGP 442 F IKLIDTVDLEGGP Sbjct: 20 FVIKLIDTVDLEGGP 34 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,794,872 Number of Sequences: 59808 Number of extensions: 172121 Number of successful extensions: 783 Number of sequences better than 10.0: 400 Number of HSP's better than 10.0 without gapping: 758 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 782 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 932979724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -