BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0313.Seq (617 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 24 1.2 AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory recept... 23 2.1 AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 22 4.7 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 22 4.7 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 22 4.7 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 22 4.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 22 4.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 22 4.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 22 4.7 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 4.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 22 4.7 AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription fa... 21 6.3 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 8.3 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.8 bits (49), Expect = 1.2 Identities = 7/27 (25%), Positives = 16/27 (59%) Frame = +1 Query: 376 ISQCQFDRNCELQVFRLGLSQDIRQRR 456 + QC++ NCE+ ++ Q+ R ++ Sbjct: 221 VYQCKYGNNCEIDMYMRRKCQECRLKK 247 >AM292369-1|CAL23181.1| 408|Tribolium castaneum gustatory receptor candidate 48 protein. Length = 408 Score = 23.0 bits (47), Expect = 2.1 Identities = 7/16 (43%), Positives = 13/16 (81%) Frame = +1 Query: 76 FVLNLDNFFKTQCVIR 123 +VLN+++FF +C I+ Sbjct: 341 YVLNMEHFFSVKCSIQ 356 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 21.8 bits (44), Expect = 4.7 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 214 ACSSVGCSKSI 246 ACSS GCS+ + Sbjct: 349 ACSSAGCSQKV 359 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 302 KPSKFFSKISVKSPALLTSGT*SRESLNVNSIGTAS 409 KP+ + ++ SPA TS T S E N+ + S Sbjct: 156 KPATSTTSQNLSSPASSTSSTSSTEKAGTNNNNSKS 191 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 302 KPSKFFSKISVKSPALLTSGT*SRESLNVNSIGTAS 409 KP+ + ++ SPA TS T S E N+ + S Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 302 KPSKFFSKISVKSPALLTSGT*SRESLNVNSIGTAS 409 KP+ + ++ SPA TS T S E N+ + S Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 302 KPSKFFSKISVKSPALLTSGT*SRESLNVNSIGTAS 409 KP+ + ++ SPA TS T S E N+ + S Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 302 KPSKFFSKISVKSPALLTSGT*SRESLNVNSIGTAS 409 KP+ + ++ SPA TS T S E N+ + S Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 302 KPSKFFSKISVKSPALLTSGT*SRESLNVNSIGTAS 409 KP+ + ++ SPA TS T S E N+ + S Sbjct: 112 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 147 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 302 KPSKFFSKISVKSPALLTSGT*SRESLNVNSIGTAS 409 KP+ + ++ SPA TS T S E N+ + S Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 302 KPSKFFSKISVKSPALLTSGT*SRESLNVNSIGTAS 409 KP+ + ++ SPA TS T S E N+ + S Sbjct: 156 KPATSTASQNLSSPASSTSSTSSTEKAGTNNNNSKS 191 >AJ415419-1|CAC94468.1| 441|Tribolium castaneum transcription factor protein. Length = 441 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/33 (24%), Positives = 15/33 (45%) Frame = -1 Query: 230 PTEEQAESVVAEPDFIFNKPYFFLILNKYNAPG 132 P + + ++ P ++N P Y+APG Sbjct: 269 PMQRPKSASLSPPPHVYNPPDHIQQATPYSAPG 301 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.0 bits (42), Expect = 8.3 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 564 MPKNFRFPRIFPDPSST 614 +P NF F ++ PSST Sbjct: 52 LPANFSFGQVNSPPSST 68 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 133,237 Number of Sequences: 336 Number of extensions: 2761 Number of successful extensions: 14 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -