BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0312.Seq (449 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g03870.2 68416.m00400 expressed protein predicted using genef... 27 5.9 At3g43520.1 68416.m04614 expressed protein contains Pfam profile... 27 7.7 >At3g03870.2 68416.m00400 expressed protein predicted using genefinder Length = 266 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = -1 Query: 422 TATHFFIGK*NTEL-KQKHG*LTLQVYTVQMALFNQI*KHREKLNDIVLNL 273 T FF+G N ++ K K+ L Q+Y+ ++ H KLN+ + + Sbjct: 197 TVCVFFLGHNNIKICKNKNQMLRFQIYSDDNKRMKEVVNHATKLNEAIFGM 247 >At3g43520.1 68416.m04614 expressed protein contains Pfam profile PF03647: Uncharacterised protein family (UPF0136) Length = 240 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/15 (66%), Positives = 11/15 (73%) Frame = +2 Query: 2 GGDQREGGANGGDGN 46 GGD+ GG GGDGN Sbjct: 101 GGDKFGGGGGGGDGN 115 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,965,342 Number of Sequences: 28952 Number of extensions: 133216 Number of successful extensions: 446 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 397 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 443 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -