BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0310.Seq (595 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g28770.1 68416.m03591 expressed protein 40 0.002 At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nic... 39 0.002 At5g53800.1 68418.m06685 expressed protein 37 0.009 At2g22795.1 68415.m02704 expressed protein 37 0.012 At5g61150.2 68418.m07672 leo1-like family protein weak similarit... 36 0.027 At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp... 36 0.027 At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing ... 35 0.047 At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase fa... 35 0.047 At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar... 35 0.047 At3g29075.1 68416.m03637 glycine-rich protein 34 0.062 At2g27470.1 68415.m03320 CCAAT-box binding transcription factor ... 34 0.062 At5g60030.1 68418.m07527 expressed protein 33 0.11 At1g76780.1 68414.m08935 expressed protein ; expression supporte... 33 0.11 At1g44910.1 68414.m05146 FF domain-containing protein / WW domai... 33 0.11 At5g60530.1 68418.m07590 late embryogenesis abundant protein-rel... 33 0.14 At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein ... 33 0.14 At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing ... 33 0.14 At1g56660.1 68414.m06516 expressed protein 33 0.14 At5g16780.1 68418.m01965 SART-1 family protein contains Pfam dom... 33 0.19 At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-asso... 33 0.19 At3g59800.1 68416.m06673 expressed protein 33 0.19 At5g16680.1 68418.m01951 PHD finger family protein contains Pfam... 32 0.25 At5g63550.1 68418.m07976 expressed protein 32 0.33 At5g61150.1 68418.m07671 leo1-like family protein weak similarit... 32 0.33 At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit... 32 0.33 At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit... 32 0.33 At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit... 32 0.33 At4g15030.1 68417.m02309 expressed protein 32 0.33 At4g35940.1 68417.m05113 expressed protein 31 0.44 At5g12230.1 68418.m01435 expressed protein 31 0.58 At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing prote... 31 0.58 At1g03530.1 68414.m00334 expressed protein similar to hypothetic... 31 0.58 At5g58880.1 68418.m07377 hypothetical protein 31 0.77 At5g56360.1 68418.m07034 calmodulin-binding protein similar to a... 31 0.77 At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (... 31 0.77 At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing ... 31 0.77 At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing ... 30 1.0 At3g60110.1 68416.m06712 DNA-binding bromodomain-containing prot... 30 1.0 At5g53440.1 68418.m06641 expressed protein 30 1.3 At5g24290.2 68418.m02858 integral membrane family protein contai... 30 1.3 At2g34300.1 68415.m04196 dehydration-responsive protein-related ... 30 1.3 At5g44690.1 68418.m05476 hypothetical protein 29 1.8 At4g33740.2 68417.m04791 expressed protein 29 1.8 At4g33740.1 68417.m04790 expressed protein 29 1.8 At4g00990.1 68417.m00133 transcription factor jumonji (jmjC) dom... 29 1.8 At2g20280.1 68415.m02369 zinc finger (CCCH-type) family protein ... 29 1.8 At5g64030.1 68418.m08039 dehydration-responsive protein-related ... 29 2.3 At4g37900.1 68417.m05360 glycine-rich protein 29 2.3 At3g51070.1 68416.m05592 dehydration-responsive protein-related ... 29 2.3 At2g29210.1 68415.m03550 splicing factor PWI domain-containing p... 29 2.3 At2g12875.1 68415.m01402 hypothetical protein 29 2.3 At1g70620.2 68414.m08137 cyclin-related contains weak similarity... 29 2.3 At1g70620.1 68414.m08138 cyclin-related contains weak similarity... 29 2.3 At1g56340.1 68414.m06476 calreticulin 1 (CRT1) identical to calr... 29 2.3 At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing pr... 29 2.3 At5g47690.1 68418.m05887 expressed protein 29 3.1 At5g22320.1 68418.m02604 leucine-rich repeat family protein cont... 29 3.1 At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28)... 29 3.1 At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-co... 29 3.1 At3g48120.1 68416.m05248 expressed protein 29 3.1 At1g67120.1 68414.m07636 midasin-related similar to Midasin (MID... 29 3.1 At1g29470.1 68414.m03605 dehydration-responsive protein-related ... 29 3.1 At1g01440.1 68414.m00059 extra-large G-protein-related weak simi... 29 3.1 At5g65770.1 68418.m08276 nuclear matrix constituent protein-rela... 28 4.1 At5g65490.1 68418.m08236 expressed protein similar to unknown pr... 28 4.1 At5g62750.1 68418.m07877 expressed protein predicted proteins, C... 28 4.1 At5g16500.1 68418.m01928 protein kinase family protein contains ... 28 4.1 At4g24580.1 68417.m03522 pleckstrin homology (PH) domain-contain... 28 4.1 At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyc... 28 4.1 At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyc... 28 4.1 At1g70505.1 68414.m08114 expressed protein 28 4.1 At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:100... 28 4.1 At1g21390.1 68414.m02676 expressed protein 28 4.1 At1g14040.1 68414.m01660 EXS family protein / ERD1/XPR1/SYG1 fam... 28 4.1 At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing ... 28 4.1 At5g01400.1 68418.m00053 expressed protein contains low similari... 28 5.4 At4g25880.2 68417.m03722 pumilio/Puf RNA-binding domain-containi... 28 5.4 At4g25880.1 68417.m03721 pumilio/Puf RNA-binding domain-containi... 28 5.4 At3g58050.1 68416.m06471 expressed protein 28 5.4 At3g18810.1 68416.m02389 protein kinase family protein contains ... 28 5.4 At1g74830.1 68414.m08670 expressed protein contains Pfam profile... 28 5.4 At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit... 28 5.4 At5g64910.1 68418.m08165 expressed protein ; expression support... 27 7.1 At5g24290.1 68418.m02857 integral membrane family protein contai... 27 7.1 At5g08450.2 68418.m00996 expressed protein KED, Nicotiana tabacu... 27 7.1 At5g08450.1 68418.m00995 expressed protein KED, Nicotiana tabacu... 27 7.1 At4g24590.1 68417.m03523 expressed protein 27 7.1 At2g43160.3 68415.m05361 epsin N-terminal homology (ENTH) domain... 27 7.1 At2g43160.2 68415.m05360 epsin N-terminal homology (ENTH) domain... 27 7.1 At2g43160.1 68415.m05359 epsin N-terminal homology (ENTH) domain... 27 7.1 At1g79280.1 68414.m09242 expressed protein weak similarity to Nu... 27 7.1 At1g69070.1 68414.m07903 expressed protein 27 7.1 At1g56110.1 68414.m06443 nucleolar protein Nop56, putative simil... 27 7.1 At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) fa... 27 7.1 At1g19990.1 68414.m02504 expressed protein ; expression supporte... 27 7.1 At1g19880.1 68414.m02493 regulator of chromosome condensation (R... 27 7.1 At5g66950.1 68418.m08440 expressed protein 27 9.4 At5g61330.1 68418.m07696 rRNA processing protein-related contain... 27 9.4 At5g59730.1 68418.m07487 exocyst subunit EXO70 family protein le... 27 9.4 At5g55660.1 68418.m06940 expressed protein similar to unknown pr... 27 9.4 At5g51410.2 68418.m06374 LUC7 N_terminus domain-containing prote... 27 9.4 At5g51410.1 68418.m06373 LUC7 N_terminus domain-containing prote... 27 9.4 At5g48610.1 68418.m06012 expressed protein ; expression supporte... 27 9.4 At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding famil... 27 9.4 At5g37010.1 68418.m04438 expressed protein 27 9.4 At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong sim... 27 9.4 At5g03680.1 68418.m00327 trihelix DNA-binding protein, putative ... 27 9.4 At4g37210.2 68417.m05267 tetratricopeptide repeat (TPR)-containi... 27 9.4 At4g37210.1 68417.m05268 tetratricopeptide repeat (TPR)-containi... 27 9.4 At4g29060.1 68417.m04157 elongation factor Ts family protein sim... 27 9.4 At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related conta... 27 9.4 At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related conta... 27 9.4 At3g11590.1 68416.m01416 expressed protein 27 9.4 At2g39260.1 68415.m04821 MIF4G domain-containing protein similar... 27 9.4 At2g35210.1 68415.m04319 human Rev interacting-like family prote... 27 9.4 At1g80930.1 68414.m09495 MIF4G domain-containing protein / MA3 d... 27 9.4 At1g66050.1 68414.m07497 zinc finger (C3HC4-type RING finger) fa... 27 9.4 At1g63420.1 68414.m07172 expressed protein 27 9.4 At1g26680.1 68414.m03250 transcriptional factor B3 family protei... 27 9.4 At1g22882.1 68414.m02857 expressed protein 27 9.4 >At3g28770.1 68416.m03591 expressed protein Length = 2081 Score = 39.5 bits (88), Expect = 0.002 Identities = 25/80 (31%), Positives = 33/80 (41%), Gaps = 1/80 (1%) Frame = -2 Query: 255 ESGVTVEREKSE-SNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN 79 E + REK E KKS+ E + E +DK R ERKS + EE + + Sbjct: 1003 EDSASKNREKKEYEEKKSKTKEEAKKEKKKSQDKKREEKDSEERKSKKEKEESRDLKAKK 1062 Query: 78 KSFNDGDASADYQTKSKKVE 19 K + KSKK E Sbjct: 1063 KEEETKEKKESENHKSKKKE 1082 Score = 38.3 bits (85), Expect = 0.004 Identities = 31/82 (37%), Positives = 42/82 (51%), Gaps = 3/82 (3%) Frame = -2 Query: 237 EREKSESNK-KSREFENKEA-ESSTYRDKNRSVNSGSERKSSGKDEEYSE-QNSSNKSFN 67 E KSE++K K +NKE ES KNR E+KS K+E E + S +K Sbjct: 980 ETTKSENSKLKEENKDNKEKKESEDSASKNREKKEYEEKKSKTKEEAKKEKKKSQDKKRE 1039 Query: 66 DGDASADYQTKSKKVEKNSARD 1 + D+ + KSKK EK +RD Sbjct: 1040 EKDSE---ERKSKK-EKEESRD 1057 Score = 35.9 bits (79), Expect = 0.020 Identities = 24/105 (22%), Positives = 52/105 (49%), Gaps = 5/105 (4%) Frame = -2 Query: 300 NQ*IIRNEDRQA*WLESGVTVEREKSESNKKSREFEN---KEAESSTYRDK-NRSVNSGS 133 N + + ED + +S + +E+++ NK+ +E E+ K E Y +K +++ Sbjct: 968 NNELKKQEDNKKETTKSENSKLKEENKDNKEKKESEDSASKNREKKEYEEKKSKTKEEAK 1027 Query: 132 ERKSSGKDEEYSEQNSSN-KSFNDGDASADYQTKSKKVEKNSARD 1 + K +D++ E++S KS + + S D + K K+ E ++ Sbjct: 1028 KEKKKSQDKKREEKDSEERKSKKEKEESRDLKAKKKEEETKEKKE 1072 Score = 31.1 bits (67), Expect = 0.58 Identities = 17/90 (18%), Positives = 42/90 (46%) Frame = -2 Query: 282 NEDRQA*WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 103 +ED ++ E +++ ES + +E + K+ E ++ N+ +E+K S + Sbjct: 1087 HEDNKSMKKEEDKKEKKKHEESKSRKKEEDKKDMEKLEDQNSNKKKEDKNEKKKSQHVKL 1146 Query: 102 YSEQNSSNKSFNDGDASADYQTKSKKVEKN 13 +++ + + + S + +S K +KN Sbjct: 1147 VKKESDKKEKKENEEKSETKEIESSKSQKN 1176 Score = 29.5 bits (63), Expect = 1.8 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRD--KNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 64 E+++S+ K +NK+ S+ RD K RS E K KD Y + K+ N Sbjct: 789 EKKESKDAKSVETKDNKKLSSTENRDEAKERSGEDNKEDKEESKD--YQSVEAKEKNENG 846 Query: 63 G-DASADYQTKSKKVE 19 G D + + SK ++ Sbjct: 847 GVDTNVGNKEDSKDLK 862 Score = 29.1 bits (62), Expect = 2.3 Identities = 22/87 (25%), Positives = 37/87 (42%), Gaps = 5/87 (5%) Frame = -2 Query: 246 VTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSS-----GKDEEYSEQNSS 82 V E +K E + + E KE ESS + + V+ E+KSS K++E E Sbjct: 1147 VKKESDKKEKKENEEKSETKEIESS--KSQKNEVDK-KEKKSSKDQQKKKEKEMKESEEK 1203 Query: 81 NKSFNDGDASADYQTKSKKVEKNSARD 1 N+ D + K +K + ++ Sbjct: 1204 KLKKNEEDRKKQTSVEENKKQKETKKE 1230 >At5g40340.1 68418.m04894 PWWP domain-containing protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 1008 Score = 39.1 bits (87), Expect = 0.002 Identities = 26/80 (32%), Positives = 44/80 (55%), Gaps = 2/80 (2%) Frame = -2 Query: 237 EREKSESNKKSREFE--NKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 64 +R+KSES K+ E E KEA ST +++ R S S+++S G++E E + S K Sbjct: 733 KRKKSESKKEGGEGEETQKEANESTKKERKRK-KSESKKQSDGEEETQKEPSESTKK-ER 790 Query: 63 GDASADYQTKSKKVEKNSAR 4 + + + K++ VE+ R Sbjct: 791 KRKNPESKKKAEAVEEEETR 810 >At5g53800.1 68418.m06685 expressed protein Length = 351 Score = 37.1 bits (82), Expect = 0.009 Identities = 19/59 (32%), Positives = 29/59 (49%) Frame = -2 Query: 258 LESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 82 LESG E+E+ ++K R + +SS R + R +S S S + EYS+ S Sbjct: 66 LESGSESEKEERRRSRKDRGKRKSDRKSSRSRRRRRDYSSSSSDSESESESEYSDSEES 124 Score = 34.7 bits (76), Expect = 0.047 Identities = 21/71 (29%), Positives = 30/71 (42%) Frame = -2 Query: 228 KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 49 +SES + + E E+E R K + E K + ++ NKS DGD Sbjct: 111 ESESESEYSDSEESESEDERRRRKRKRKEREEEEKERKRRRREKDKKKRNKSDKDGDKKR 170 Query: 48 DYQTKSKKVEK 16 + K KK EK Sbjct: 171 K-EKKKKKSEK 180 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = -3 Query: 365 TGSDDSDKNRGKDTDDKYSETGTNKSSETKTGKRDGSRAASQSKGKN 225 +GS+ + R + D+ KSS ++ +RD S ++S S+ ++ Sbjct: 68 SGSESEKEERRRSRKDRGKRKSDRKSSRSRRRRRDYSSSSSDSESES 114 >At2g22795.1 68415.m02704 expressed protein Length = 734 Score = 36.7 bits (81), Expect = 0.012 Identities = 21/95 (22%), Positives = 48/95 (50%) Frame = -2 Query: 285 RNEDRQA*WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 106 +NED++ +ES E ++ E K +E E+ E + ++ N S + KD+ Sbjct: 484 KNEDKETEKIESSFLEETKEKEDETKEKE-ESSSQEKTEEKETETKDNEESSSQEETKDK 542 Query: 105 EYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARD 1 E + + + + S + +T++K+ E++S+++ Sbjct: 543 E--NEKIEKEEASSQEESKENETETKEKEESSSQE 575 Score = 35.1 bits (77), Expect = 0.036 Identities = 19/79 (24%), Positives = 39/79 (49%), Gaps = 3/79 (3%) Frame = -2 Query: 243 TVEREKSESNKKSREFEN---KEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 73 T E+E+S S ++++E EN ++ ES+ + N E++ S EE E+ + K Sbjct: 565 TKEKEESSSQEETKEKENEKIEKEESAPQEETKEKENEKIEKEESASQEETKEKETETKE 624 Query: 72 FNDGDASADYQTKSKKVEK 16 + ++ + + + EK Sbjct: 625 KEESSSNESQENVNTESEK 643 Score = 34.7 bits (76), Expect = 0.047 Identities = 17/79 (21%), Positives = 45/79 (56%), Gaps = 1/79 (1%) Frame = -2 Query: 240 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN-D 64 +E+E+S ++++E EN++ E ++++ S E+++ K++E S N S ++ N + Sbjct: 585 IEKEESAPQEETKEKENEKIE----KEESASQEETKEKETETKEKEESSSNESQENVNTE 640 Query: 63 GDASADYQTKSKKVEKNSA 7 + + KK +++++ Sbjct: 641 SEKKEQVEENEKKTDEDTS 659 Score = 33.1 bits (72), Expect = 0.14 Identities = 21/84 (25%), Positives = 40/84 (47%), Gaps = 4/84 (4%) Frame = -2 Query: 249 GVTVEREKS--ESNKKSREFENKEAESSTYRDK--NRSVNSGSERKSSGKDEEYSEQNSS 82 G REKS E ++ + +N +E S +K NR ++ E K DE+ + + + Sbjct: 239 GTEESREKSGTEESEVEEKKDNGSSEESEVEEKKENRGIDESEESKEKDIDEKANIEEAR 298 Query: 81 NKSFNDGDASADYQTKSKKVEKNS 10 ++ DAS++ +S++ S Sbjct: 299 ENNYKGDDASSEVVHESEEKTSES 322 Score = 32.7 bits (71), Expect = 0.19 Identities = 21/78 (26%), Positives = 36/78 (46%), Gaps = 2/78 (2%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG-SERKSSGKDEEYS-EQNSS 82 E+G T E EKS S + E + + R+K+ + S E+K +G EE E+ Sbjct: 214 ENGGTEENEKSGSEESEVEEKKDNGGTEESREKSGTEESEVEEKKDNGSSEESEVEEKKE 273 Query: 81 NKSFNDGDASADYQTKSK 28 N+ ++ + S + K Sbjct: 274 NRGIDESEESKEKDIDEK 291 Score = 30.3 bits (65), Expect = 1.0 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 5/82 (6%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSG-SERKSSGKDEEYSEQNSSN 79 ++G T E EKS + + E E KE + +K+ S S E+K +G EE E++ + Sbjct: 192 DNGGTEENEKSGTEESEVE-ERKENGGTEENEKSGSEESEVEEKKDNGGTEESREKSGTE 250 Query: 78 KS----FNDGDASADYQTKSKK 25 +S D +S + + + KK Sbjct: 251 ESEVEEKKDNGSSEESEVEEKK 272 Score = 29.9 bits (64), Expect = 1.3 Identities = 22/86 (25%), Positives = 45/86 (52%) Frame = -2 Query: 258 LESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN 79 +E +E+E ++SN +S K S + S S S+ +S GK+ E ++ S+ Sbjct: 385 MEKNELLEKEFNDSNGES-SVTGKSTGSGDGGSQETSEVS-SQEESKGKESETKDKEESS 442 Query: 78 KSFNDGDASADYQTKSKKVEKNSARD 1 + S D +T++K+ E++S+++ Sbjct: 443 SQ----EESKDRETETKEKEESSSQE 464 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/86 (20%), Positives = 36/86 (41%), Gaps = 1/86 (1%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGS-ERKSSGKDEEYSEQNSSN 79 E T E E E EN+++ + + R N G+ E + SG +E E+ N Sbjct: 156 EKSGTEESEVEERKDNGGTEENEKSGTEESEVEERKDNGGTEENEKSGTEESEVEERKEN 215 Query: 78 KSFNDGDASADYQTKSKKVEKNSARD 1 + + S +++ ++ + N + Sbjct: 216 GGTEENEKSGSEESEVEEKKDNGGTE 241 Score = 29.1 bits (62), Expect = 2.3 Identities = 20/88 (22%), Positives = 38/88 (43%), Gaps = 3/88 (3%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE--RKSSGKDEEYSEQNSS 82 E T E E E + EN+++ S + + N G+E R+ SG +E E+ Sbjct: 200 EKSGTEESEVEERKENGGTEENEKSGSEESEVEEKKDNGGTEESREKSGTEESEVEEKKD 259 Query: 81 NKSFNDGDASADYQTKS-KKVEKNSARD 1 N S + + + + + E++ +D Sbjct: 260 NGSSEESEVEEKKENRGIDESEESKEKD 287 >At5g61150.2 68418.m07672 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 623 Score = 35.5 bits (78), Expect = 0.027 Identities = 20/78 (25%), Positives = 40/78 (51%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 + E SES ++ E+E +E E + R +S E + +++E E+ SN+ ++D D Sbjct: 516 QMEYSESEREESEYETEEEEEEKSPARGRGKDSEDEYEEDAEEDE-EERGKSNR-YSDED 573 Query: 57 ASADYQTKSKKVEKNSAR 4 + +++K + S R Sbjct: 574 EEEEEGGRAEKDHRGSGR 591 >At5g23080.1 68418.m02698 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 930 Score = 35.5 bits (78), Expect = 0.027 Identities = 22/83 (26%), Positives = 41/83 (49%), Gaps = 6/83 (7%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSG----SERKSSGKDEEYSEQNSSNKSFN 67 +EK E S ++E +S R+K+ SG S +SSG + N ++ N Sbjct: 801 KEKVEEKTSSLTLGSEEEKSRKKREKSPGKRSGGNDLSSSESSGDERRRKRYNKKDRHRN 860 Query: 66 D--GDASADYQTKSKKVEKNSAR 4 D D+S+DY ++ K+ ++ ++ Sbjct: 861 DSESDSSSDYHSRDKQGSRSRSK 883 >At5g09880.1 68418.m01142 RNA recognition motif (RRM)-containing protein Length = 527 Score = 34.7 bits (76), Expect = 0.047 Identities = 27/81 (33%), Positives = 39/81 (48%) Frame = -2 Query: 243 TVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 64 TVE E + SNKK E N+ +E S YR + G ER+ EE + S KS D Sbjct: 12 TVE-EGAGSNKKKEESGNERSERS-YRKRE-----GGERQGEEGGEEERVSSRSKKSRGD 64 Query: 63 GDASADYQTKSKKVEKNSARD 1 G+ + + ++ S+RD Sbjct: 65 GEENGGGKRDRERERHRSSRD 85 >At2g43900.1 68415.m05457 endonuclease/exonuclease/phosphatase family protein belongs to Pfam:PF03372: Endonuclease/Exonuclease/phosphatase family; contains 3 WD-40 repeats (PF00400);similar to Type II inositol-1,4,5-trisphosphate 5-phosphatase EC 3.1.3.56 (5PTASE) (INPP5B) (SP:P32019) [Homo sapiens] Length = 1305 Score = 34.7 bits (76), Expect = 0.047 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Frame = -2 Query: 225 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF--NDGDAS 52 S+S+KKS N ++ + D N + S+ S+ K + S+ +S++KS +DGD+ Sbjct: 1146 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSC 1205 Query: 51 ADYQTKS 31 + Q KS Sbjct: 1206 SKSQKKS 1212 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Frame = -2 Query: 225 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF--NDGDAS 52 S+S+KKS N ++ + D N + S+ S+ K + S+ +S++KS +DGD++ Sbjct: 1122 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSN 1181 Query: 51 ADYQTKS 31 + KS Sbjct: 1182 SKSSKKS 1188 Score = 33.5 bits (73), Expect = 0.11 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 2/67 (2%) Frame = -2 Query: 225 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF--NDGDAS 52 S+S+KKS N ++ + D N + S+ S+ K + S+ +S++KS +DGD++ Sbjct: 1134 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSN 1193 Query: 51 ADYQTKS 31 + KS Sbjct: 1194 SKSSKKS 1200 Score = 33.5 bits (73), Expect = 0.11 Identities = 18/74 (24%), Positives = 38/74 (51%) Frame = -2 Query: 225 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASAD 46 S+S+KKS N ++ + D N + S+ S K ++ S+ ++++KS GD + Sbjct: 1170 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSCSKSQKKSDGDTNSKSQKKGDGDSS 1229 Query: 45 YQTKSKKVEKNSAR 4 ++ K +S++ Sbjct: 1230 SKSHKKNDGDSSSK 1243 Score = 32.3 bits (70), Expect = 0.25 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 2/66 (3%) Frame = -2 Query: 225 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS--FNDGDAS 52 S+S+KKS N ++ + D N + S+ S+ K + S+ +S +KS +DGD + Sbjct: 1158 SKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSNSKSSKKSDGDSCSKSQKKSDGDTN 1217 Query: 51 ADYQTK 34 + Q K Sbjct: 1218 SKSQKK 1223 >At1g20920.1 68414.m02619 DEAD box RNA helicase, putative similar to RNA helicase [Rattus norvegicus] GI:897915; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain Length = 1166 Score = 34.7 bits (76), Expect = 0.047 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 5/75 (6%) Frame = -2 Query: 228 KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS-----EQNSSNKSFND 64 ++ ++SRE N+E++ RD R G ERK +++ E + KS D Sbjct: 195 RNRERERSREVGNEESDDDVKRDLKRRRKEGGERKEKEREKSVGRSSRHEDSPKRKSVED 254 Query: 63 GDASADYQTKSKKVE 19 + +T+ +++E Sbjct: 255 NGEKKEKKTREEELE 269 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/70 (24%), Positives = 36/70 (51%) Frame = -2 Query: 285 RNEDRQA*WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 106 R +DR+ ++S + + + +++ + + KE E RDK+R RKSS ++ Sbjct: 45 REKDRRKKRVKSSDSEDDYDRDDDEEREKRKEKERERRR-RDKDRVKRRSERRKSSDSED 103 Query: 105 EYSEQNSSNK 76 + E++ +K Sbjct: 104 DVEEEDERDK 113 Score = 27.9 bits (59), Expect = 5.4 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 6/85 (7%) Frame = -2 Query: 240 VEREKSESNKKSREFENKEAE-SSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 64 +E EKS+ + + +EA+ + RD++R +ERK E+ E++ K Sbjct: 1 MEVEKSKYRSEDLDVVEEEADLKKSRRDRDR----SNERKKDKGSEKRREKDRRKKRVKS 56 Query: 63 GDASADY-----QTKSKKVEKNSAR 4 D+ DY + + K+ EK R Sbjct: 57 SDSEDDYDRDDDEEREKRKEKERER 81 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/79 (24%), Positives = 34/79 (43%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 ER++ + K+ RE E + +DK R ER+ ++E E+ + D Sbjct: 127 ERDRGKDRKRDREREER-------KDKEREREKDRERREREREEREKERVKERERRERED 179 Query: 57 ASADYQTKSKKVEKNSARD 1 D + + K E+ S R+ Sbjct: 180 GERDRREREK--ERGSRRN 196 >At3g29075.1 68416.m03637 glycine-rich protein Length = 294 Score = 34.3 bits (75), Expect = 0.062 Identities = 14/58 (24%), Positives = 30/58 (51%) Frame = -2 Query: 231 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 EKS+ +K ++ + K+ +++ D+ + + K D++Y E+ K +ND D Sbjct: 159 EKSKKKEKEKKKDKKKDGNNSEDDEFKKKKKKEQYKEHHDDDDYDEKKKKKKDYNDDD 216 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/60 (23%), Positives = 30/60 (50%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 +++K +N + EF+ K+ + Y++ + + E+K KD ++ K +ND D Sbjct: 171 DKKKDGNNSEDDEFKKKKKKEQ-YKEHHDD-DDYDEKKKKKKDYNDDDEKKKKKHYNDDD 228 Score = 28.3 bits (60), Expect = 4.1 Identities = 19/78 (24%), Positives = 34/78 (43%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 55 ++ + ++KS++ E KE + +D N S + E K K E+Y E + + Sbjct: 152 KDYDDGDEKSKKKE-KEKKKDKKKDGNNSEDD--EFKKKKKKEQYKEHHDDDDYDEKKKK 208 Query: 54 SADYQTKSKKVEKNSARD 1 DY +K +K D Sbjct: 209 KKDYNDDDEKKKKKHYND 226 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 362 GSDDSDKNRGKDTDDKYSETGTNKSSETKTGKRDGSRA 249 G D K+ GKD DD ++ + + K K+DG+ + Sbjct: 142 GDDGHKKHSGKDYDDGDEKSKKKEKEKKKDKKKDGNNS 179 >At2g27470.1 68415.m03320 CCAAT-box binding transcription factor subunit HAP3-related contains Pfam PF00808 : Histone-like transcription factor (CBF/NF-Y) and archaeal histone; similar to polymerase epsilon p17 subunit (DNA polymerase epsilon subunit 3) (YB-like protein 1) (YBL1) (NF-YB-like protein) (SP:Q9JKP7) [Mus musculus]; Length = 275 Score = 34.3 bits (75), Expect = 0.062 Identities = 15/77 (19%), Positives = 35/77 (45%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 E E ++ + E++ + +T + N N + +G DEE +++ N +G+ Sbjct: 172 ENGNDEEDENGNDEEDENDDENTEENGNDEENDDENTEENGNDEENEKEDEENSMEENGN 231 Query: 57 ASADYQTKSKKVEKNSA 7 S + + +E+N + Sbjct: 232 ESEESGNEDHSMEENGS 248 Score = 31.1 bits (67), Expect = 0.58 Identities = 18/78 (23%), Positives = 33/78 (42%), Gaps = 1/78 (1%) Frame = -2 Query: 243 TVEREKSESNKKSREFENKEAESSTYRDKNRSVN-SGSERKSSGKDEEYSEQNSSNKSFN 67 T E E N EN E + D+ S+ +G+E + SG ++ E+N S + Sbjct: 194 TEENGNDEENDDENTEENGNDEENEKEDEENSMEENGNESEESGNEDHSMEENGSGVGED 253 Query: 66 DGDASADYQTKSKKVEKN 13 + + ++VE + Sbjct: 254 NENEDGSVSGSGEEVESD 271 Score = 29.5 bits (63), Expect = 1.8 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 3/88 (3%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYR--DKNRSVNSGSERKSSGKDEEYSEQNSS 82 E+G E E + + EN E + D+N N G++ ++ +DEE S + + Sbjct: 172 ENGNDEEDENGNDEEDENDDENTEENGNDEENDDENTEEN-GNDEENEKEDEENSMEENG 230 Query: 81 NKSFNDGDASADYQTKSKKV-EKNSARD 1 N+S G+ + V E N D Sbjct: 231 NESEESGNEDHSMEENGSGVGEDNENED 258 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/74 (22%), Positives = 28/74 (37%) Frame = -2 Query: 222 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADY 43 E N E EN E D+N N E D+E +E+N +++ D Sbjct: 171 EENGNDEEDENGNDEEDENDDENTEENGNDEEN----DDENTEENGNDEENEKEDEENSM 226 Query: 42 QTKSKKVEKNSARD 1 + + E++ D Sbjct: 227 EENGNESEESGNED 240 >At5g60030.1 68418.m07527 expressed protein Length = 292 Score = 33.5 bits (73), Expect = 0.11 Identities = 28/103 (27%), Positives = 51/103 (49%), Gaps = 7/103 (6%) Frame = -2 Query: 288 IRNEDRQA*WLESGVTVEREKSESNKKSREFE------NKEAESSTYRDKNRSVNSGSER 127 IR + +A +ES ER++ + KKS++ + N++ E+ ++ R ++ Sbjct: 97 IRYRNSEAVSVESVYGRERDEKKM-KKSKDADVVDEKVNEKLEAEQRSEERRERKKEKKK 155 Query: 126 KSSGKDEEYSEQNSSNKSFNDGDASAD-YQTKSKKVEKNSARD 1 K + KDE+ ++ K D SAD + K KK +KN+ D Sbjct: 156 KKNNKDEDVVDEKVKEK-LEDEQKSADRKERKKKKSKKNNDED 197 >At1g76780.1 68414.m08935 expressed protein ; expression supported by MPSS Length = 1871 Score = 33.5 bits (73), Expect = 0.11 Identities = 21/83 (25%), Positives = 38/83 (45%) Frame = -2 Query: 252 SGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 73 S +++ K E K + E E + + + S + E K S + E+Y++QN + Sbjct: 1477 SSTKIQQTKDELEKPRKPSEISE-NHNIHEFMDSSQSQDIEEKGSDQAEKYAKQNKIQEV 1535 Query: 72 FNDGDASADYQTKSKKVEKNSAR 4 ND D +Y S++V A+ Sbjct: 1536 MNDEDKKEEYHI-SERVRNEMAK 1557 >At1g44910.1 68414.m05146 FF domain-containing protein / WW domain-containing protein contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 946 Score = 33.5 bits (73), Expect = 0.11 Identities = 19/79 (24%), Positives = 32/79 (40%), Gaps = 1/79 (1%) Frame = -2 Query: 237 EREKSESNKKSR-EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 61 E+E+ +K R E E E E +DK R K GK+ E++ + + Sbjct: 796 EKERKRDEEKVRKEKERDEKEKRKDKDKERREKEREREKEKGKERSKREESDGETAMDVS 855 Query: 60 DASADYQTKSKKVEKNSAR 4 + D + K K ++ R Sbjct: 856 EGHKDEKRKGKDRDRKHRR 874 >At5g60530.1 68418.m07590 late embryogenesis abundant protein-related / LEA protein-related similar to late embryogenesis abundant protein [Picea glauca] GI:1350543 Length = 439 Score = 33.1 bits (72), Expect = 0.14 Identities = 18/75 (24%), Positives = 35/75 (46%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 76 E ++EK + +K+ +E ++KE + +DK ERK + E+ + K Sbjct: 69 EKAAKDKKEKEKKDKEEKEKKDKERKEKEKKDKLEKEKKDKERKEKERKEK-ERKAKEKK 127 Query: 75 SFNDGDASADYQTKS 31 + +A+A Y+ S Sbjct: 128 DKEESEAAARYRILS 142 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/71 (21%), Positives = 28/71 (39%) Frame = -2 Query: 222 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADY 43 E KK +E K+ + +DK ERK K ++ ++ + + Sbjct: 62 EQEKKDKEKAAKDKKEKEKKDKEEKEKKDKERKEKEKKDKLEKEKKDKERKEKERKEKER 121 Query: 42 QTKSKKVEKNS 10 + K KK ++ S Sbjct: 122 KAKEKKDKEES 132 >At3g62240.1 68416.m06992 zinc finger (C2H2 type) family protein contains Pfam PF00096: Zinc finger, C2H2 type Length = 812 Score = 33.1 bits (72), Expect = 0.14 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 4/82 (4%) Frame = -2 Query: 243 TVEREKSESNKKSREFENKEAESSTYR-DKNRSVNSGSERKSSGKDEEYSEQNSSNK-SF 70 TV R +S N + E E + +TYR DK +S G++ S+G ++ + + ++ Sbjct: 701 TVRRLQSSQNPQEEEEEAISKDKNTYRSDKGKSQVVGTDSSSTGSKQQRKKTSKFHRVRL 760 Query: 69 NDGDASA--DYQTKSKKVEKNS 10 DG +A D +++ E+ S Sbjct: 761 GDGSMAALLDLNNSTRESEQES 782 >At2g22100.1 68415.m02625 RNA recognition motif (RRM)-containing protein similar to UBP1 interacting protein 1a [Arabidopsis thaliana] GI:19574236; contains Pfam profile: PF00076 RNA recognition motif (aka RRM, RBD, or RNP domain) Length = 382 Score = 33.1 bits (72), Expect = 0.14 Identities = 20/79 (25%), Positives = 37/79 (46%), Gaps = 1/79 (1%) Frame = -2 Query: 237 EREKSESNKKSR-EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 61 ER+K + KK R E + +EAE R+K S S+ K K E+ +++ + + Sbjct: 7 ERKKEKKEKKERKERKRREAEELAVREKKISKKHKSKSKEEEKPEKSKKKSKKYEEVEEE 66 Query: 60 DASADYQTKSKKVEKNSAR 4 + S KK +++ + Sbjct: 67 EKSPSPSPSPKKSKESKKK 85 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 33.1 bits (72), Expect = 0.14 Identities = 21/75 (28%), Positives = 32/75 (42%), Gaps = 1/75 (1%) Frame = -2 Query: 225 SESNKKSREFENKEAESSTYR-DKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 49 +E KK + E KE + ST + DK G K +DE + D +A Sbjct: 260 AEEKKKKPDKEKKEKDESTEKEDKKLKGKKGKGEKPEKEDEGKKTKEHDATEQEMDDEAA 319 Query: 48 DYQTKSKKVEKNSAR 4 D++ KK K+ A+ Sbjct: 320 DHKEGKKKKNKDKAK 334 Score = 29.9 bits (64), Expect = 1.3 Identities = 17/76 (22%), Positives = 35/76 (46%), Gaps = 2/76 (2%) Frame = -2 Query: 237 EREKSESNKKSREF--ENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 64 E + +E KKS+ E++E + +DK ++ ++ +DEE + +S + Sbjct: 407 EEDDTEEKKKSKVEGGESEEGKKKKKKDKKKNKKKDTKEPKMTEDEEEKKDDSKDVKIEG 466 Query: 63 GDASADYQTKSKKVEK 16 A + + K K +K Sbjct: 467 SKAKEEKKDKDVKKKK 482 Score = 27.1 bits (57), Expect = 9.4 Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 6/66 (9%) Frame = -2 Query: 255 ESGVTVEREKSESNKK----SREFENKEAESSTYRDKNRSVNSGSE-RKSSGKDE-EYSE 94 ESG + +K++ KK S+E E E E K SG+E +K K E + E Sbjct: 143 ESGPEEKNKKADKEKKHEDVSQEKEELEEEDGKKNKKKEKDESGTEEKKKKPKKEKKQKE 202 Query: 93 QNSSNK 76 ++ SN+ Sbjct: 203 ESKSNE 208 >At5g16780.1 68418.m01965 SART-1 family protein contains Pfam domain, PF03343: SART-1 family Length = 820 Score = 32.7 bits (71), Expect = 0.19 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSRE-FENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN 79 E ++ R+K KSR+ + K+ E R K+R N K KD ++ +S Sbjct: 75 EKEISRGRDKEREKDKSRDRVKEKDKEKERNRHKDRE-NERDNEKEKDKDRARVKERASK 133 Query: 78 KSFNDGD 58 KS D D Sbjct: 134 KSHEDDD 140 Score = 31.9 bits (69), Expect = 0.33 Identities = 19/77 (24%), Positives = 41/77 (53%), Gaps = 6/77 (7%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRS-VNSGSERKSSGKDEEYSE-----QNSSNK 76 E++K + + ++ EN E ++ +DK+R+ V + +KS D+E + ++S N+ Sbjct: 97 EKDKEKERNRHKDREN-ERDNEKEKDKDRARVKERASKKSHEDDDETHKAAERYEHSDNR 155 Query: 75 SFNDGDASADYQTKSKK 25 N+G + D + K+ Sbjct: 156 GLNEGGDNVDAASSGKE 172 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/80 (20%), Positives = 42/80 (52%), Gaps = 1/80 (1%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERK-SSGKDEEYSEQNSSNKSFNDG 61 ++EK +K R+ +++ + RD+ RS + +E++ S G+D+E + S ++ Sbjct: 41 DKEKDYDREKIRDKDHRR-DKEKERDRKRSRDEDTEKEISRGRDKEREKDKSRDRVKEKD 99 Query: 60 DASADYQTKSKKVEKNSARD 1 + K ++ E+++ ++ Sbjct: 100 KEKERNRHKDRENERDNEKE 119 >At4g37820.1 68417.m05351 expressed protein Kaposi's sarcoma-associated herpes-like virus ORF73gene, Kaposi's sarcoma-associated herpesvirus, U52064 Length = 532 Score = 32.7 bits (71), Expect = 0.19 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 5/77 (6%) Frame = -2 Query: 231 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE---EYSEQNSSNKSFNDG 61 E+ E K E KEAE + + N N+G K + E E S + + ++ Sbjct: 109 EREEEEKAVEENNEKEAEGTGNEEGNEDSNNGESEKVVDESEGGNEISNEEAREINYKGD 168 Query: 60 DASAD--YQTKSKKVEK 16 DAS++ + T+ K EK Sbjct: 169 DASSEVMHGTEEKSNEK 185 Score = 28.7 bits (61), Expect = 3.1 Identities = 18/81 (22%), Positives = 40/81 (49%) Frame = -2 Query: 243 TVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 64 T E+ S+SN + E + ++ + + S SGS KS+G + +E++ K + Sbjct: 247 TGEKGFSDSNGELPETNLSTSNATETTESSGSDESGSSGKSTGYQQTKNEEDEKEKVQSS 306 Query: 63 GDASADYQTKSKKVEKNSARD 1 + S ++ + + +S++D Sbjct: 307 EEESKVKESGKNEKDASSSQD 327 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/74 (25%), Positives = 35/74 (47%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 E S+ + +E E KE E S+ ++ N N +E+KSS + + E +S K + Sbjct: 378 EASSSQEENEIKETEIKEKEESSSQEGNE--NKETEKKSS--ESQRKENTNSEKKIEQVE 433 Query: 57 ASADYQTKSKKVEK 16 ++ T+ +K Sbjct: 434 STDSSNTQKGDEQK 447 >At3g59800.1 68416.m06673 expressed protein Length = 186 Score = 32.7 bits (71), Expect = 0.19 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 76 E + + + ++ S+ KSR+ + K+ +S + K R S SE SS ++E SS+K Sbjct: 90 ERSLKLSKGRNYSSDKSRK-DKKDRDSKKKKSKKRKHYSSSESSSSSDEDESRRSRSSSK 148 >At5g16680.1 68418.m01951 PHD finger family protein contains Pfam domain, PF00628: PHD-finger Length = 1290 Score = 32.3 bits (70), Expect = 0.25 Identities = 21/63 (33%), Positives = 28/63 (44%) Frame = -2 Query: 240 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 61 V EK +KSR NKE + + RS E + GK + S NSS S ++ Sbjct: 218 VSSEKGNFKEKSRPGGNKERQEPSVEGSTRS----GENRKDGKSSKSSSSNSSAVSESES 273 Query: 60 DAS 52 D S Sbjct: 274 DDS 276 >At5g63550.1 68418.m07976 expressed protein Length = 530 Score = 31.9 bits (69), Expect = 0.33 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = -3 Query: 356 DDSDKNRGKDTDDKYSETGTNKSSETKTGKRDGSRAASQSKGKNPNPT 213 ++SD + DTDD+ E K S+ K+ + +S SKGK+ P+ Sbjct: 315 EESDHEK-TDTDDEKDEVEVEKPSKKKSSSKKTVEESSGSKGKDKQPS 361 >At5g61150.1 68418.m07671 leo1-like family protein weak similarity to SP|P38439 LEO1 protein {Saccharomyces cerevisiae}; contains Pfam profile PF04004: Leo1-like protein; supporting cDNA gi|21929714|gb|AF490422.1| Length = 625 Score = 31.9 bits (69), Expect = 0.33 Identities = 18/78 (23%), Positives = 35/78 (44%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 + E SES ++ E+E +E E + R +S E + +++E S+ S D + Sbjct: 516 QMEYSESEREESEYETEEEEEEKSPARGRGKDSEDEYEEDAEEDEEERGKSNRYSDEDEE 575 Query: 57 ASADYQTKSKKVEKNSAR 4 +++K + S R Sbjct: 576 EEEVAGGRAEKDHRGSGR 593 Score = 30.7 bits (66), Expect = 0.77 Identities = 20/63 (31%), Positives = 31/63 (49%) Frame = -2 Query: 285 RNEDRQA*WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 106 R +D + + E E E+ +SN+ S E E +E + +K+ SG +RK DE Sbjct: 544 RGKDSEDEYEEDAEEDEEERGKSNRYSDEDEEEEEVAGGRAEKDHR-GSGRKRKGIESDE 602 Query: 105 EYS 97 E S Sbjct: 603 EES 605 >At4g36690.3 68417.m05206 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 565 Score = 31.9 bits (69), Expect = 0.33 Identities = 27/104 (25%), Positives = 51/104 (49%), Gaps = 1/104 (0%) Frame = -2 Query: 309 RDRNQ*IIRNEDRQA*WLESGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGS 133 RD + R++DR+ E G +RE+ SE +++SR+ + ++++ + RDK+R Sbjct: 42 RDHERETSRSKDRER---EKGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERH 97 Query: 132 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARD 1 R S +D + D D DY+ +S+ + + RD Sbjct: 98 HRSSRHRDHSRERGERRERGGRDDD---DYR-RSRDRDHDRRRD 137 Score = 31.5 bits (68), Expect = 0.44 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE---YSEQNSSNKSFN 67 E+ K S K R+ + SS +RD +R G R+ G+D++ S ++ + Sbjct: 80 EKSKERSRDKDRDHRERHHRSSRHRDHSRE--RGERRERGGRDDDDYRRSRDRDHDRRRD 137 Query: 66 DGDASADYQTKSKKVEKNSAR 4 D +++S+ +++ R Sbjct: 138 DRGGRRSRRSRSRSKDRSERR 158 >At4g36690.2 68417.m05207 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 542 Score = 31.9 bits (69), Expect = 0.33 Identities = 27/104 (25%), Positives = 51/104 (49%), Gaps = 1/104 (0%) Frame = -2 Query: 309 RDRNQ*IIRNEDRQA*WLESGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGS 133 RD + R++DR+ E G +RE+ SE +++SR+ + ++++ + RDK+R Sbjct: 42 RDHERETSRSKDRER---EKGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERH 97 Query: 132 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARD 1 R S +D + D D DY+ +S+ + + RD Sbjct: 98 HRSSRHRDHSRERGERRERGGRDDD---DYR-RSRDRDHDRRRD 137 Score = 31.5 bits (68), Expect = 0.44 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE---YSEQNSSNKSFN 67 E+ K S K R+ + SS +RD +R G R+ G+D++ S ++ + Sbjct: 80 EKSKERSRDKDRDHRERHHRSSRHRDHSRE--RGERRERGGRDDDDYRRSRDRDHDRRRD 137 Query: 66 DGDASADYQTKSKKVEKNSAR 4 D +++S+ +++ R Sbjct: 138 DRGGRRSRRSRSRSKDRSERR 158 >At4g36690.1 68417.m05205 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit [Nicotiana plumbaginifolia] GI:3850823 Length = 573 Score = 31.9 bits (69), Expect = 0.33 Identities = 27/104 (25%), Positives = 51/104 (49%), Gaps = 1/104 (0%) Frame = -2 Query: 309 RDRNQ*IIRNEDRQA*WLESGVTVEREK-SESNKKSREFENKEAESSTYRDKNRSVNSGS 133 RD + R++DR+ E G +RE+ SE +++SR+ + ++++ + RDK+R Sbjct: 42 RDHERETSRSKDRER---EKGRDKDRERDSEVSRRSRDRDGEKSKERS-RDKDRDHRERH 97 Query: 132 ERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSARD 1 R S +D + D D DY+ +S+ + + RD Sbjct: 98 HRSSRHRDHSRERGERRERGGRDDD---DYR-RSRDRDHDRRRD 137 Score = 31.5 bits (68), Expect = 0.44 Identities = 18/81 (22%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE---YSEQNSSNKSFN 67 E+ K S K R+ + SS +RD +R G R+ G+D++ S ++ + Sbjct: 80 EKSKERSRDKDRDHRERHHRSSRHRDHSRE--RGERRERGGRDDDDYRRSRDRDHDRRRD 137 Query: 66 DGDASADYQTKSKKVEKNSAR 4 D +++S+ +++ R Sbjct: 138 DRGGRRSRRSRSRSKDRSERR 158 >At4g15030.1 68417.m02309 expressed protein Length = 179 Score = 31.9 bits (69), Expect = 0.33 Identities = 17/58 (29%), Positives = 28/58 (48%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 64 E E+SESN+K ++ N+ S Y G RKS K E + +++F++ Sbjct: 114 EGERSESNEKKKQKRNRSQSHSEYDTDEEDRRKGKTRKS--KLESADREGKDDENFDE 169 >At4g35940.1 68417.m05113 expressed protein Length = 451 Score = 31.5 bits (68), Expect = 0.44 Identities = 19/75 (25%), Positives = 32/75 (42%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 E+ K E +K R + K+ + R + + ++ GK E SE+ S + + Sbjct: 32 EKAKKEQRRKDRRSDKKDKKDKKERKEKKEKKEKKRKEREGK-EVGSEKRSHKRRRKEDG 90 Query: 57 ASADYQTKSKKVEKN 13 A D K K+ E N Sbjct: 91 AKVDLFHKLKESEVN 105 >At5g12230.1 68418.m01435 expressed protein Length = 221 Score = 31.1 bits (67), Expect = 0.58 Identities = 17/80 (21%), Positives = 41/80 (51%), Gaps = 1/80 (1%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 +R+K + +++ ++ ++K + S +DK++ + ++ ++S+++ K +DGD Sbjct: 134 DRDK-DKDREHKKHKHKHKDRSKDKDKDKDRDRKKDKNGHHDSGDHSKKHHDKKRKHDGD 192 Query: 57 ASA-DYQTKSKKVEKNSARD 1 D Q K K+S D Sbjct: 193 EDLNDVQRHKKNKHKSSKLD 212 >At3g03340.1 68416.m00332 LUC7 N_terminus domain-containing protein contains Pfam domain PF03194: LUC7 N_terminus Length = 402 Score = 31.1 bits (67), Expect = 0.58 Identities = 19/82 (23%), Positives = 41/82 (50%), Gaps = 5/82 (6%) Frame = -2 Query: 231 EKSESNK-KSREFENKEAESSTYRDK----NRSVNSGSERKSSGKDEEYSEQNSSNKSFN 67 EK+ K +S+E +KE ESS R+K +R +R+S +D + ++ ++ Sbjct: 311 EKANIRKERSKERNSKERESSKDREKEQETSREHRRDYDRRSRDRDRHHDRDREQDRDYD 370 Query: 66 DGDASADYQTKSKKVEKNSARD 1 + + +++S+ ++ RD Sbjct: 371 RSHSRSRRRSRSRSRSRDRPRD 392 >At1g03530.1 68414.m00334 expressed protein similar to hypothetical protein GB:O14360 Length = 797 Score = 31.1 bits (67), Expect = 0.58 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = -2 Query: 231 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF 70 EKS+ K + E+E+S+ + S +S SE + S +DE E+N + F Sbjct: 233 EKSDEAKGEMDSAESESETSS-SSASSSDSSSSEEEESDEDESDKEENKKEEKF 285 >At5g58880.1 68418.m07377 hypothetical protein Length = 1088 Score = 30.7 bits (66), Expect = 0.77 Identities = 24/78 (30%), Positives = 40/78 (51%) Frame = -2 Query: 240 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 61 +E E + +++ KEA T D ++SV S RKS K+ E +++ SNK D Sbjct: 369 LENEYIDHTEQNLPLNGKEA---TIEDDDKSVVS---RKSEEKEVEMNDETDSNKEECD- 421 Query: 60 DASADYQTKSKKVEKNSA 7 D+S +++S+ N A Sbjct: 422 DSSCSEESESELCRLNKA 439 >At5g56360.1 68418.m07034 calmodulin-binding protein similar to alpha glucosidase II beta subunit from GI:2104691 [Mus musculus] Length = 647 Score = 30.7 bits (66), Expect = 0.77 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Frame = -2 Query: 186 EAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN---KSFNDGDASADYQTKSKKVE 19 E E ++ D+ N E K+E S ++SS+ +S NDG A + + KKVE Sbjct: 281 EGEPTSILDEATHTNPADEHVVERKEESTSSEDSSSPTDESQNDGSAEKEESDEVKKVE 339 >At3g50670.1 68416.m05542 U1 small nuclear ribonucleoprotein 70 (U1-70k) Length = 427 Score = 30.7 bits (66), Expect = 0.77 Identities = 14/59 (23%), Positives = 30/59 (50%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 REK + ++SRE +++ + RD+ R +R G+D + + +++ + GD Sbjct: 269 REKGKERERSRELSHEQPRERS-RDRPREDKHHRDRDQGGRDRDRDSRRDRDRTRDRGD 326 >At3g23900.1 68416.m03003 RNA recognition motif (RRM)-containing protein Length = 987 Score = 30.7 bits (66), Expect = 0.77 Identities = 19/78 (24%), Positives = 32/78 (41%) Frame = -2 Query: 252 SGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 73 +G R + E R+ E + + T R ++RSV ++ K +DEE ++S Sbjct: 628 AGSRSPRRRKEVKSTPRDDEENKVKRRT-RSRSRSVEDSADIKDKSRDEELKHHKKRSRS 686 Query: 72 FNDGDASADYQTKSKKVE 19 + D S T E Sbjct: 687 RSREDRSKTRDTSRNSDE 704 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG-D 58 +E SE ++ R+ ++ E + R +RS E KS+ +D+E ++ +S + + Sbjct: 605 QEDSELSRLRRDSSSR-GEKKSSRAGSRSPRRRKEVKSTPRDDEENKVKRRTRSRSRSVE 663 Query: 57 ASADYQTKSKKVE 19 SAD + KS+ E Sbjct: 664 DSADIKDKSRDEE 676 >At5g25060.1 68418.m02970 RNA recognition motif (RRM)-containing protein KIAA0332 - Homo sapiens, EMBL:AB002330 Length = 946 Score = 30.3 bits (65), Expect = 1.0 Identities = 18/78 (23%), Positives = 38/78 (48%), Gaps = 1/78 (1%) Frame = -2 Query: 231 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS-EQNSSNKSFNDGDA 55 +KS +K + +++E+ +R +N+S RKSS ++ ++ ++ + D D Sbjct: 851 QKSIIERKEKREDSQESSKKRHRGENKS--QSPPRKSSTRERDHDLGRDRDRERHRDRDR 908 Query: 54 SADYQTKSKKVEKNSARD 1 D + EK+S+ D Sbjct: 909 QHDLNRDRDRREKSSSHD 926 Score = 28.7 bits (61), Expect = 3.1 Identities = 20/88 (22%), Positives = 41/88 (46%), Gaps = 1/88 (1%) Frame = -2 Query: 306 DRNQ*-IIRNEDRQA*WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 130 +RNQ II ++++ ES R +++S R+ +E + RD++R + + Sbjct: 848 NRNQKSIIERKEKREDSQESSKKRHRGENKSQSPPRKSSTRERDHDLGRDRDRERHRDRD 907 Query: 129 RKSSGKDEEYSEQNSSNKSFNDGDASAD 46 R+ + + SS+ +D D S + Sbjct: 908 RQHDLNRDRDRREKSSSHDRDDNDRSKE 935 >At3g60110.1 68416.m06712 DNA-binding bromodomain-containing protein contains bromodomain, INTERPRO:IPR001487 Length = 438 Score = 30.3 bits (65), Expect = 1.0 Identities = 19/79 (24%), Positives = 34/79 (43%), Gaps = 1/79 (1%) Frame = -2 Query: 243 TVEREKSESNKKSREFENKEAESSTYRDKNR-SVNSGSERKSSGKDEEYSEQNSSNKSFN 67 T S + S+E ++ T R KN + ++ +SS D++ E+NS + Sbjct: 262 TATTSARSSRRTSKEIAVVAKDTKTGRAKNNIKKQTDTKTESSDDDDDEKEENSKTEKKT 321 Query: 66 DGDASADYQTKSKKVEKNS 10 D K+++KNS Sbjct: 322 VADKKKSVADFLKRIKKNS 340 >At5g53440.1 68418.m06641 expressed protein Length = 1181 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/65 (23%), Positives = 27/65 (41%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 55 R++ +++ R + ++ S Y + S ER + +Q+ K DG Sbjct: 367 RDRDRDHERDRTHDREKDRSRDYYHDGKRSKSDRERDNDRDVSRLDDQSGRYKDRRDGRR 426 Query: 54 SADYQ 40 S DYQ Sbjct: 427 SPDYQ 431 Score = 28.7 bits (61), Expect = 3.1 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 2/54 (3%) Frame = -3 Query: 365 TGSDDSDKNRGKDTDDKYSETGTNKSSETKTGKRD--GSRAASQSKGKNPNPTR 210 +G SD+ GKD DDK + K S K+ KRD +S GK+ R Sbjct: 80 SGESGSDRWNGKD-DDKGESSKKTKVSSEKSRKRDEGDGEETKKSSGKSDGKHR 132 Score = 28.3 bits (60), Expect = 4.1 Identities = 20/82 (24%), Positives = 37/82 (45%), Gaps = 6/82 (7%) Frame = -2 Query: 231 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSER------KSSGKDEEYSEQNSSNKSF 70 E + S+ K R+ ++ E+ S + K+ S++ KS +DE E+ + Sbjct: 67 EYTSSSSKRRKGKSGESGSDRWNGKDDDKGESSKKTKVSSEKSRKRDEGDGEETKKSSGK 126 Query: 69 NDGDASADYQTKSKKVEKNSAR 4 +DG + +SK V+K R Sbjct: 127 SDGKHRESSRRESKDVDKEKDR 148 >At5g24290.2 68418.m02858 integral membrane family protein contains Pfam domain PF01988: Integral membrane protein Length = 534 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 3/49 (6%) Frame = -3 Query: 356 DDSDKNRGKDT---DDKYSETGTNKSSETKTGKRDGSRAASQSKGKNPN 219 +D+D ++ +D + SETG+N+ SET + + +G+ S PN Sbjct: 68 EDNDGSQAQDPIVLESTVSETGSNEESETGSNEENGNNWLESSSTNLPN 116 >At2g34300.1 68415.m04196 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 29.9 bits (64), Expect = 1.3 Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = -2 Query: 231 EKSESNKKSREFENKEAESSTYRDKN-RSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 55 EK+E+ ++ +E ++ + ++KN + V S S+ + + + E NKS DG+ Sbjct: 112 EKTEAGEERKESDDNNGDGDGEKEKNVKEVGSESDETTQKEKTQLEESTEENKS-EDGNG 170 Query: 54 SAD 46 + + Sbjct: 171 NEE 173 >At5g44690.1 68418.m05476 hypothetical protein Length = 684 Score = 29.5 bits (63), Expect = 1.8 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 3/67 (4%) Frame = -2 Query: 285 RNEDRQA*WLESGVTVEREKSESNKK---SREFENKEAESSTYRDKNRSVNSGSERKSSG 115 RNE+R+ E G ++E E+ SN + S ++E + T R R SG E KSS Sbjct: 369 RNEERRK--KEEGKSMEIEEYRSNPQEVTSVVCLDREKDEETARQVFRE--SGKEEKSSQ 424 Query: 114 KDEEYSE 94 DEE S+ Sbjct: 425 NDEETSK 431 >At4g33740.2 68417.m04791 expressed protein Length = 227 Score = 29.5 bits (63), Expect = 1.8 Identities = 19/82 (23%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAES---STYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN 67 ++ K E+ E E E E DKN+ +E E E + ++S N Sbjct: 106 KKSKVENGNHEEEVEKDEEEEVAEDDEEDKNKQGEEVAEEDEEENKHEEDEIDEQDQSKN 165 Query: 66 DGDASADYQTKSKKVEKNSARD 1 GD D +T ++ E + + Sbjct: 166 AGDTDKDDETLEEEKESGMSEN 187 >At4g33740.1 68417.m04790 expressed protein Length = 227 Score = 29.5 bits (63), Expect = 1.8 Identities = 19/82 (23%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAES---STYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN 67 ++ K E+ E E E E DKN+ +E E E + ++S N Sbjct: 106 KKSKVENGNHEEEVEKDEEEEVAEDDEEDKNKQGEEVAEEDEEENKHEEDEIDEQDQSKN 165 Query: 66 DGDASADYQTKSKKVEKNSARD 1 GD D +T ++ E + + Sbjct: 166 AGDTDKDDETLEEEKESGMSEN 187 >At4g00990.1 68417.m00133 transcription factor jumonji (jmjC) domain-containing protein contains Pfam domain, PF02373: jmjC domain Length = 840 Score = 29.5 bits (63), Expect = 1.8 Identities = 17/71 (23%), Positives = 37/71 (52%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 +++ +E+ + +++ + E+S +N+S+ E K KD+ +E+ S+N S G Sbjct: 576 QKKYAEAMLQKQQYSGQVKEASEL--ENKSMKEVDESKKDLKDKAANEEQSNNSSRPSGS 633 Query: 57 ASADYQTKSKK 25 A+ SK+ Sbjct: 634 GEAEKVIISKE 644 >At2g20280.1 68415.m02369 zinc finger (CCCH-type) family protein contains Pfam domain, PF00642: Zinc finger C-x8-C-x5-C-x3-H type (and similar) Length = 371 Score = 29.5 bits (63), Expect = 1.8 Identities = 16/62 (25%), Positives = 32/62 (51%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 ERE+ E+ +K++ NKEAE+ T + + S E +D++ + + ++ + Sbjct: 296 EREQEETEQKAK---NKEAEAGTSKSSGDAEQSSKEVNEEEEDDDDDDDDLDMDELDELE 352 Query: 57 AS 52 AS Sbjct: 353 AS 354 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = -2 Query: 201 EFEN-KEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 E+E +E E + + KN+ +G+ KSSG E+ S++ + + +D D Sbjct: 292 EYEREREQEETEQKAKNKEAEAGTS-KSSGDAEQSSKEVNEEEEDDDDD 339 >At5g64030.1 68418.m08039 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 829 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/72 (25%), Positives = 38/72 (52%), Gaps = 1/72 (1%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGS-ERKSSGKDEEYSEQNSSNKSFNDG 61 + E ++N+K + E ++ E + + S + E+KS D++ S+ + NK+ N+ Sbjct: 162 DEENPDTNEKQTKPETEDNELGEDGENQKQFESDNGEKKSIDDDKKSSDDDKENKTGNE- 220 Query: 60 DASADYQTKSKK 25 D +TK++K Sbjct: 221 ----DTETKTEK 228 >At4g37900.1 68417.m05360 glycine-rich protein Length = 787 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = -3 Query: 353 DSDKNRGKDTDDKYSETGTNKSSETKTGKRDGSRAASQSKGKNPNP 216 DSD+++GK D +S GT E G+R +A + ++G P P Sbjct: 254 DSDRSKGKKLDTGFS--GTTAQWEETFGRRYW-KAGAMNRGNTPKP 296 >At3g51070.1 68416.m05592 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 895 Score = 29.1 bits (62), Expect = 2.3 Identities = 16/71 (22%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVN-SGSERKSSGKDEEYSEQNSSN 79 E+ E E+ + K +EFE ++ + RD++ G++ + G+ +E + N Sbjct: 144 ENQTVQESEEGQMKKVVKEFEKEQKQQ---RDEDAGTQPKGTQGQEQGQGKEQPDVEQGN 200 Query: 78 KSFNDGDASAD 46 K + D++ D Sbjct: 201 KQGQEQDSNTD 211 >At2g29210.1 68415.m03550 splicing factor PWI domain-containing protein contains Pfam profile PF01480: PWI domain Length = 878 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/80 (23%), Positives = 34/80 (42%) Frame = -2 Query: 240 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 61 VE+E + + ++K+ +DKNR N S R+ D+ S +S + Sbjct: 734 VEKEDNSDLDANLSCDSKDTIRHQIKDKNRRKNKRSSREEVSSDDNGS-SDSDVDDRKEA 792 Query: 60 DASADYQTKSKKVEKNSARD 1 + K++K EK R+ Sbjct: 793 KRRRKEEKKTRKEEKKRRRE 812 >At2g12875.1 68415.m01402 hypothetical protein Length = 325 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = -2 Query: 228 KSESNKKSREFENK--EAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 55 K+ + + S +NK EA DKN S + + ++EE SE+ + +DG+ Sbjct: 92 KATTEEPSSTEQNKAIEAVKEDKYDKNEEEKSEKDEQEKSEEEE-SEEEEKEEGNDDGEE 150 Query: 54 SADYQTKSKK 25 S++ T +++ Sbjct: 151 SSNDSTTTEE 160 >At1g70620.2 68414.m08137 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 884 Score = 29.1 bits (62), Expect = 2.3 Identities = 20/85 (23%), Positives = 32/85 (37%), Gaps = 4/85 (4%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS----EQN 88 + G E+EK E + R EN + + + S+RKS + S Sbjct: 789 DRGKRKEKEKEEERSRHRRAENSSKDKRRRSPTSNESSDDSKRKSRSRRRSVSPSPVRSR 848 Query: 87 SSNKSFNDGDASADYQTKSKKVEKN 13 S + ++S D + KS KN Sbjct: 849 RKRSSPSSDESSDDSKRKSSSKRKN 873 >At1g70620.1 68414.m08138 cyclin-related contains weak similarity to Swiss-Prot:P35662 cylicin I (Multiple-band polypeptide I) [Bos taurus] Length = 897 Score = 29.1 bits (62), Expect = 2.3 Identities = 20/85 (23%), Positives = 32/85 (37%), Gaps = 4/85 (4%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS----EQN 88 + G E+EK E + R EN + + + S+RKS + S Sbjct: 759 DRGKRKEKEKEEERSRHRRAENSSKDKRRRSPTSNESSDDSKRKSRSRRRSVSPSPVRSR 818 Query: 87 SSNKSFNDGDASADYQTKSKKVEKN 13 S + ++S D + KS KN Sbjct: 819 RKRSSPSSDESSDDSKRKSSSKRKN 843 >At1g56340.1 68414.m06476 calreticulin 1 (CRT1) identical to calreticulin (crt1) GI:2052379 [Arabidopsis thaliana] Length = 425 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/61 (31%), Positives = 28/61 (45%), Gaps = 2/61 (3%) Frame = -2 Query: 222 ESNKKSREFENKEA--ESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 49 E+ KK E E+K+A ES + N G + + K EE E + K + DA+ Sbjct: 364 EAEKKREEEESKDAPAESDAEEEAEDDDNEGDDSDNESKSEETKEAEET-KEAEETDAAH 422 Query: 48 D 46 D Sbjct: 423 D 423 >At1g15340.1 68414.m01835 methyl-CpG-binding domain-containing protein contains Pfam profile PF01429: Methyl-CpG binding domain Length = 384 Score = 29.1 bits (62), Expect = 2.3 Identities = 26/81 (32%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVN-SGSERKSSGKDEEYSEQNSSNKSFNDG 61 E EK + +K+ E ENKEAE RDK S+ SE + E +E+ S + D Sbjct: 188 EAEKEKEGEKA-EAENKEAE--VVRDKKESMEVDTSELEKKAGSGEGAEEPSKVEGLKDT 244 Query: 60 D-ASADYQTKSKKVEKNSARD 1 + A VEK A + Sbjct: 245 EMKEAQEVVTEADVEKKPAEE 265 >At5g47690.1 68418.m05887 expressed protein Length = 1638 Score = 28.7 bits (61), Expect = 3.1 Identities = 22/68 (32%), Positives = 31/68 (45%), Gaps = 4/68 (5%) Frame = -2 Query: 246 VTVEREKSES-NKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY---SEQNSSN 79 +++E EK ES NKK R + E S + +S + G K DEE E Sbjct: 1531 LSLEHEKVESRNKKRRSSALPKTEYSGEAGEEKSESEGKSLKEGEDDEEVVNKEEDLQEA 1590 Query: 78 KSFNDGDA 55 K+ + GDA Sbjct: 1591 KTESSGDA 1598 >At5g22320.1 68418.m02604 leucine-rich repeat family protein contains leucine rich repeat (LRR) domains, Pfam:PF00560 Length = 452 Score = 28.7 bits (61), Expect = 3.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 329 DTDDKYSETGTNKSSETKTGKRDGSRAASQSKGKN 225 DTDD+ + NKS+E + K D R S + K+ Sbjct: 274 DTDDETFDAYHNKSAEEEQSKEDRKRKKSSKRNKS 308 >At4g16630.1 68417.m02514 DEAD/DEAH box helicase, putative (RH28) identical to cDNA DEAD box RNA helicase, RH28 GI:3776026 Length = 789 Score = 28.7 bits (61), Expect = 3.1 Identities = 14/82 (17%), Positives = 38/82 (46%) Frame = -2 Query: 285 RNEDRQA*WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDE 106 R+ D Q+ W + + + + + + + K +++ +R S+N E + +D Sbjct: 65 RDADAQSPWDFASYSSSVGEEHARRHTTSIDEKISKAIQHRPVPISINEEEEEEEEEEDA 124 Query: 105 EYSEQNSSNKSFNDGDASADYQ 40 +E + + ++ D +A+Y+ Sbjct: 125 SDAETDKQEEYLSEDDEAAEYK 146 >At4g11560.1 68417.m01853 bromo-adjacent homology (BAH) domain-containing protein contains Pfam profile PF01426: BAH domain Length = 587 Score = 28.7 bits (61), Expect = 3.1 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNS 85 +R K ++ K +FE KEA+ R K R N E + G D++ E+ + Sbjct: 37 KRRKRKTVKLYEDFEEKEAD----RKKKRKGNKEDEDMAEGDDDQAEEETN 83 >At3g48120.1 68416.m05248 expressed protein Length = 328 Score = 28.7 bits (61), Expect = 3.1 Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTY--RDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFN 67 RE+ E +K R S+Y R++ RS + +ER++ D E +++ ++S + Sbjct: 103 RERDERDKSHRRRSRSSERRSSYVDRERRRSRSRSAERRNRYGDRESRRRSNRSRSLS 160 Score = 28.7 bits (61), Expect = 3.1 Identities = 20/84 (23%), Positives = 45/84 (53%), Gaps = 4/84 (4%) Frame = -2 Query: 240 VEREKSESNKKSREFENK--EAESSTYRDKNRSVNSGSERKS-SGKDEEYSEQNSSNKSF 70 V+RE+ S +S E N+ + ES +++RS++ ER+S E+ + + K + Sbjct: 126 VDRERRRSRSRSAERRNRYGDRESRRRSNRSRSLSPRRERRSREDVKEKKPDYSRLIKGY 185 Query: 69 NDGDASADYQTKSK-KVEKNSARD 1 ++ A+ + K K ++++ + +D Sbjct: 186 DEMSAAEKVKAKMKLQLDETAEKD 209 >At1g67120.1 68414.m07636 midasin-related similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q12019) [Saccharomyces cerevisiae]; similar to Midasin (MIDAS-containing protein) (Swiss-Prot:Q9NU22) [Homo sapiens]; contains Prosite PS00017: ATP/GTP-binding site motif A (P-loop) Length = 5336 Score = 28.7 bits (61), Expect = 3.1 Identities = 20/74 (27%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSER---KSSGKDEEYSEQNSSNKSFND 64 +E S S + + E++ +E + V S +E+ K KDEE E+N + K+ Sbjct: 4545 KEYSVSEDEEEDKEDEGSEDEPLDNGIGDVGSDAEKADEKPWNKDEEDEEENMNEKN-ES 4603 Query: 63 GDASADYQTKSKKV 22 G + D T+S+++ Sbjct: 4604 GPSIVDKDTRSREL 4617 >At1g29470.1 68414.m03605 dehydration-responsive protein-related similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 770 Score = 28.7 bits (61), Expect = 3.1 Identities = 17/72 (23%), Positives = 39/72 (54%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 E++ + ++++ E + E S+ ++N+S +S +++G+ SE+N+ KS + Sbjct: 135 EKDTESESDETKQKEKTQLEESS--EENKSEDSNGTEENAGE----SEENTEKKSEENAG 188 Query: 57 ASADYQTKSKKV 22 + + KSK V Sbjct: 189 ETEESTEKSKDV 200 Score = 27.5 bits (58), Expect = 7.1 Identities = 19/67 (28%), Positives = 30/67 (44%), Gaps = 1/67 (1%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 76 ES T ++EK++ + S E NK +S+ + +E+KS E E +K Sbjct: 141 ESDETKQKEKTQLEESSEE--NKSEDSNGTEENAGESEENTEKKSEENAGETEESTEKSK 198 Query: 75 S-FNDGD 58 F GD Sbjct: 199 DVFPAGD 205 >At1g01440.1 68414.m00059 extra-large G-protein-related weak similarity to extra-large G-protein (AtXLG1) (GI:3201682) [Arabidopsis thaliana] Length = 664 Score = 28.7 bits (61), Expect = 3.1 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 6/72 (8%) Frame = -2 Query: 225 SESNKKSREFENKEAESSTYRDKNRSVNS----GSER--KSSGKDEEYSEQNSSNKSFND 64 S + + R F+ ES+T +NR +S GS+R KSS K+EE +SS+K+ Sbjct: 14 SSRSDEDRGFKEDLNESATSPMRNRLDDSNSRPGSQRFVKSSRKEEETDSDSSSSKNTTT 73 Query: 63 GDASADYQTKSK 28 + Y K + Sbjct: 74 RNNPIQYTDKQQ 85 >At5g65770.1 68418.m08276 nuclear matrix constituent protein-related low similarity to nuclear matrix constituent protein 1 (NMCP1) [Daucus carota] GI:2190187 Length = 1042 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/36 (50%), Positives = 19/36 (52%) Frame = -3 Query: 110 TRSTVNRTPVINPLTTAMHRLTTKPNLRRLKRILPE 3 T S R P I P T A +RLT PN R LK L E Sbjct: 3 TSSRSERFP-ITPSTAATNRLTITPNSRVLKSPLTE 37 >At5g65490.1 68418.m08236 expressed protein similar to unknown protein (dbj BAA75199.1) Length = 643 Score = 28.3 bits (60), Expect = 4.1 Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 5/76 (6%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSV---NSGSERKSSGKD--EEYSEQNSSNKSF 70 +E S+ S ++ ++ +S +++ + + NS ERK+ GK+ E S +++ +F Sbjct: 398 QEVPASDNDSWLYDGEDELNSVLQERQKEMEFYNSKKERKNKGKEKQEAGSSSDANMNNF 457 Query: 69 NDGDASADYQTKSKKV 22 + GD S Q KV Sbjct: 458 DLGDISKSMQQFMHKV 473 >At5g62750.1 68418.m07877 expressed protein predicted proteins, Caenorhabditis elegans Length = 124 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/70 (21%), Positives = 31/70 (44%) Frame = -2 Query: 222 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADY 43 E+ +K + +NKE E + ++ ++ KD+ ++N + D + + Sbjct: 3 ETEEKVKNHDNKEEE---HNKAEKAEKKEKKKDKDKKDKNEDDKNGGGEEGEDQEKKSKK 59 Query: 42 QTKSKKVEKN 13 + K K EKN Sbjct: 60 KDKKAKKEKN 69 >At5g16500.1 68418.m01928 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 636 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/55 (27%), Positives = 25/55 (45%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 73 E+E+ ++KK +E E +S D N + E+ K E S +S + S Sbjct: 418 EKEEESTSKKRQEQEETATDSDDESDSNSEKDQEEEQSQLEKARESSSSSSDSGS 472 Score = 27.1 bits (57), Expect = 9.4 Identities = 21/84 (25%), Positives = 39/84 (46%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 76 E T ++S+SN + + E + + S +SGSER+S DE + S Sbjct: 432 EETATDSDDESDSNSEKDQEEEQSQLEKARESSSSSSDSGSERRSI--DETNATAQSLKI 489 Query: 75 SFNDGDASADYQTKSKKVEKNSAR 4 S++ + S++ + K K+S + Sbjct: 490 SYS--NYSSEEEDNEKLSSKSSCK 511 >At4g24580.1 68417.m03522 pleckstrin homology (PH) domain-containing protein-related / RhoGAP domain-containing protein contains Pfam domain, PF00620: RhoGAP domain Length = 902 Score = 28.3 bits (60), Expect = 4.1 Identities = 15/47 (31%), Positives = 23/47 (48%) Frame = -2 Query: 144 NSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSAR 4 + GS+ DEE +N SN S+++ AS D S + + AR Sbjct: 445 DDGSQGSEDYTDEEEDLENESNGSYSESAASEDKYADSIDPDDHKAR 491 >At3g63400.2 68416.m07138 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 387 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -2 Query: 129 RKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSAR 4 R + E + SNK+F+ GD S +++K E N R Sbjct: 179 RAHDAAEREKGKSKKSNKNFSPGDVSDREAKETRKKESNEKR 220 >At3g63400.1 68416.m07137 peptidyl-prolyl cis-trans isomerase cyclophilin-type family protein similar to cyclophylin [Digitalis lanata] GI:1563719; contains Pfam profile PF00160: peptidyl-prolyl cis-trans isomerase, cyclophilin-type; contains AT-donor splice site at intron 9 Length = 570 Score = 28.3 bits (60), Expect = 4.1 Identities = 13/42 (30%), Positives = 20/42 (47%) Frame = -2 Query: 129 RKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSAR 4 R + E + SNK+F+ GD S +++K E N R Sbjct: 179 RAHDAAEREKGKSKKSNKNFSPGDVSDREAKETRKKESNEKR 220 >At1g70505.1 68414.m08114 expressed protein Length = 338 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/52 (34%), Positives = 26/52 (50%) Frame = -2 Query: 258 LESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEE 103 L S V++ R +S N ++R + E TYR + NS + SSG D E Sbjct: 149 LGSLVSIYRFRSPDNGENR-VSIVDEEQGTYRPPGNAENSNVFKSSSGHDRE 199 >At1g28400.1 68414.m03492 expressed protein similar to E6 (GI:1000090) [Gossypium barbadense] Length = 335 Score = 28.3 bits (60), Expect = 4.1 Identities = 18/82 (21%), Positives = 37/82 (45%), Gaps = 4/82 (4%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG-- 61 +E+ +N K+ E N + S+ + + E K E Y + +N+ FN+ Sbjct: 98 KEEFNNNNKNDEKVNSKTFSTPSLSETEESFNNYEENYPKKTENYGTKGYNNEEFNNNNN 157 Query: 60 --DASADYQTKSKKVEKNSARD 1 DA+ + + K ++N A++ Sbjct: 158 KYDANFKEEFNNNKYDENYAKE 179 >At1g21390.1 68414.m02676 expressed protein Length = 248 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -2 Query: 210 KSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYS 97 + +E+ N+ +ESST R + S N+ +SS +DE+ S Sbjct: 185 EDKEWWNRMSESSTKRSGSSSSNNSIRSRSSLRDEKSS 222 >At1g14040.1 68414.m01660 EXS family protein / ERD1/XPR1/SYG1 family protein similar to PHO1 protein [Arabidopsis thaliana] GI:20069032; contains Pfam profiles PF03105: SPX domain, PF03124: EXS family Length = 798 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 323 DDKYSETGTNKSSETKTGKRDGSRAASQSKGKNPNP 216 DD+ E N++S TG D S+ +G P+P Sbjct: 232 DDEEDEDEQNETSVVSTGAIDNETTTSRMRGARPSP 267 >At1g13190.1 68414.m01529 RNA recognition motif (RRM)-containing protein Length = 573 Score = 28.3 bits (60), Expect = 4.1 Identities = 25/84 (29%), Positives = 38/84 (45%), Gaps = 13/84 (15%) Frame = -2 Query: 231 EKSESNKKSREFENKEAESSTYRDKNR-------SVNSGSERKSSGKDE-----EYSEQ- 91 E+ S E E +E E RDK R S NSG R S ++E EY +Q Sbjct: 471 EEGGSEYGGYEDETQEKEEKPSRDKERATTERDWSENSGDRRHKSHREEKDSHREYKQQR 530 Query: 90 NSSNKSFNDGDASADYQTKSKKVE 19 + + F+ G +S +++S+ E Sbjct: 531 DRDSDEFDRGQSSLKSRSRSRMSE 554 >At5g01400.1 68418.m00053 expressed protein contains low similarity to symplekin SP:Q92797 from [Homo sapiens] Length = 1467 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = -3 Query: 347 DKNRGKDTDDKYSETGTNKSSETKTGKRDGSRAASQSKGKNPNPT 213 D R + ++ + S G ++SS TG+ D S+ S P PT Sbjct: 1370 DTGRSEMSESQSSPIGQSQSSPIGTGQSDMSQTPQVSDSSAPEPT 1414 >At4g25880.2 68417.m03722 pumilio/Puf RNA-binding domain-containing protein contains Pfam profile:PF00806 Pumilio-family RNA binding domains Length = 852 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 123 SSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 22 SSG+ ++S NSSN N D S ++ S V Sbjct: 169 SSGQTPQHSRSNSSNGEVNTADESGNFSELSDDV 202 >At4g25880.1 68417.m03721 pumilio/Puf RNA-binding domain-containing protein contains Pfam profile:PF00806 Pumilio-family RNA binding domains Length = 861 Score = 27.9 bits (59), Expect = 5.4 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 123 SSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 22 SSG+ ++S NSSN N D S ++ S V Sbjct: 169 SSGQTPQHSRSNSSNGEVNTADESGNFSELSDDV 202 >At3g58050.1 68416.m06471 expressed protein Length = 1209 Score = 27.9 bits (59), Expect = 5.4 Identities = 17/71 (23%), Positives = 31/71 (43%), Gaps = 4/71 (5%) Frame = -2 Query: 246 VTVERE----KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSN 79 +T+E++ + E +K E E KE + S R+K + K GK+++ E + + Sbjct: 523 ITLEKQVKLLEEEEKEKREEEERKEKKRSKEREKKLRKKERLKEKDKGKEKKNPECSDKD 582 Query: 78 KSFNDGDASAD 46 N D Sbjct: 583 MLLNSSREEED 593 >At3g18810.1 68416.m02389 protein kinase family protein contains Pfam PF00069: Protein kinase domain Length = 700 Score = 27.9 bits (59), Expect = 5.4 Identities = 14/76 (18%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Frame = -2 Query: 225 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASAD 46 +++N + N + + +D N + N+ + ++G D + N +N N+ + Sbjct: 82 NDNNNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNNGNDNNGNNNNGNNNDNNNQNNGGG 141 Query: 45 YQTKS-KKVEKNSARD 1 +S +NS R+ Sbjct: 142 SNNRSPPPPSRNSDRN 157 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/49 (22%), Positives = 23/49 (46%), Gaps = 1/49 (2%) Frame = -3 Query: 362 GSDDSDKNRGKDTDDKYS-ETGTNKSSETKTGKRDGSRAASQSKGKNPN 219 G++++D N G + +D + G N + +D + + + G N N Sbjct: 69 GNNNNDGNNGNNNNDNNNNNNGNNNNDNNNGNNKDNNNNGNNNNGNNNN 117 >At1g74830.1 68414.m08670 expressed protein contains Pfam profile PF04576: Protein of unknown function, DUF593 Length = 542 Score = 27.9 bits (59), Expect = 5.4 Identities = 15/54 (27%), Positives = 27/54 (50%) Frame = -2 Query: 225 SESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 64 SE K+ E + EAE YR+K + + + EE+ +QN + +++D Sbjct: 378 SELAKREEEMKELEAEFEVYREKYGCLTDQEDAR-----EEFHKQNGNASAYDD 426 >At1g60900.1 68414.m06856 U2 snRNP auxiliary factor large subunit, putative similar to U2 snRNP auxiliary factor, large subunit GB:CAA77136 from [Nicotiana plumbaginifolia] Length = 589 Score = 27.9 bits (59), Expect = 5.4 Identities = 19/102 (18%), Positives = 40/102 (39%) Frame = -2 Query: 309 RDRNQ*IIRNEDRQA*WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSE 130 +D N+ R +DR E +REKS + RE +RD++R + Sbjct: 60 KDGNKDRDREKDRDR---EKSRDRDREKSRDRDRDRERSKDRQRDRHHRDRHRDRSRERS 116 Query: 129 RKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNSAR 4 K D+++ ++ D + + + + ++ +R Sbjct: 117 EKRDDLDDDHHRRSRDRDRRRSRDRDREVRHRRRSRSRSRSR 158 >At5g64910.1 68418.m08165 expressed protein ; expression supported by MPSS Length = 487 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/83 (20%), Positives = 28/83 (33%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNK 76 E V + E + EN+E E++ K E K+EE E +K Sbjct: 53 EDKVESPAPEEEGKNEEEANENQEEEAAKVESKAAEEGGNEEEAKEDKEEEKEEAAREDK 112 Query: 75 SFNDGDASADYQTKSKKVEKNSA 7 + D K+ K ++ Sbjct: 113 EEEEEAVKPDESASQKEEAKGAS 135 >At5g24290.1 68418.m02857 integral membrane family protein contains Pfam domain PF01988: Integral membrane protein Length = 550 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 311 SETGTNKSSETKTGKRDGSRAASQSKGKNPN 219 SETG+N+ SET + + +G+ S PN Sbjct: 102 SETGSNEESETGSNEENGNNWLESSSTNLPN 132 >At5g08450.2 68418.m00996 expressed protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 918 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/92 (15%), Positives = 42/92 (45%) Frame = -2 Query: 288 IRNEDRQA*WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 109 I E+R++ E ++++ + +K ++ +E + ++ +++ E + + Sbjct: 394 IGREERESDRWERERMEQKDRERNKEKDKDHIKREPRTGAEKEISQNEKELGEASAKPSE 453 Query: 108 EEYSEQNSSNKSFNDGDASADYQTKSKKVEKN 13 +EY ++ D + +TK K+ E++ Sbjct: 454 QEYVAPEQKKQNEPDNCEKDERETKEKRRERD 485 >At5g08450.1 68418.m00995 expressed protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 918 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/92 (15%), Positives = 42/92 (45%) Frame = -2 Query: 288 IRNEDRQA*WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKD 109 I E+R++ E ++++ + +K ++ +E + ++ +++ E + + Sbjct: 394 IGREERESDRWERERMEQKDRERNKEKDKDHIKREPRTGAEKEISQNEKELGEASAKPSE 453 Query: 108 EEYSEQNSSNKSFNDGDASADYQTKSKKVEKN 13 +EY ++ D + +TK K+ E++ Sbjct: 454 QEYVAPEQKKQNEPDNCEKDERETKEKRRERD 485 >At4g24590.1 68417.m03523 expressed protein Length = 241 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = -2 Query: 141 SGSERKSSGKDEEYSEQNSSNKSFND-GDASAD--YQTKSKKVEKNSARD 1 +G E+ S ++EE E + S +D GD AD Y +VE N R+ Sbjct: 52 NGGEQSESPEEEEEEESDREEPSASDPGDPEADKFYDLIKSRVECNDFRE 101 >At2g43160.3 68415.m05361 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/66 (21%), Positives = 34/66 (51%) Frame = -2 Query: 201 EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 22 ++ +++ E S+Y + +R S +D + ++S ++ DG+ DY+ +S+ V Sbjct: 180 DYGSRDEERSSYGREREYGYRDDDRNS--RDGDRHSRDSEDRYGRDGNRDDDYRGRSRSV 237 Query: 21 EKNSAR 4 + +R Sbjct: 238 DNYGSR 243 >At2g43160.2 68415.m05360 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/66 (21%), Positives = 34/66 (51%) Frame = -2 Query: 201 EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 22 ++ +++ E S+Y + +R S +D + ++S ++ DG+ DY+ +S+ V Sbjct: 180 DYGSRDEERSSYGREREYGYRDDDRNS--RDGDRHSRDSEDRYGRDGNRDDDYRGRSRSV 237 Query: 21 EKNSAR 4 + +R Sbjct: 238 DNYGSR 243 >At2g43160.1 68415.m05359 epsin N-terminal homology (ENTH) domain-containing protein contains Pfam PF01417: ENTH domain. ENTH (Epsin N-terminal homology) domain; similar to Af10-protein (GI:1724114) [Avena fatua] Length = 895 Score = 27.5 bits (58), Expect = 7.1 Identities = 14/66 (21%), Positives = 34/66 (51%) Frame = -2 Query: 201 EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 22 ++ +++ E S+Y + +R S +D + ++S ++ DG+ DY+ +S+ V Sbjct: 180 DYGSRDEERSSYGREREYGYRDDDRNS--RDGDRHSRDSEDRYGRDGNRDDDYRGRSRSV 237 Query: 21 EKNSAR 4 + +R Sbjct: 238 DNYGSR 243 >At1g79280.1 68414.m09242 expressed protein weak similarity to Nucleoprotein TPR (Swiss-Prot:P12270) [Homo sapiens] Length = 2111 Score = 27.5 bits (58), Expect = 7.1 Identities = 22/72 (30%), Positives = 32/72 (44%) Frame = -2 Query: 279 EDRQA*WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEY 100 +DR A +S + +S +K E E E S R + E+K D E Sbjct: 83 DDRLAELAQSQAQKHQLHLQSIEKDGEVERMSTEMSELHKSKRQLMELLEQK----DAEI 138 Query: 99 SEQNSSNKSFND 64 SE+NS+ KS+ D Sbjct: 139 SEKNSTIKSYLD 150 >At1g69070.1 68414.m07903 expressed protein Length = 901 Score = 27.5 bits (58), Expect = 7.1 Identities = 17/58 (29%), Positives = 29/58 (50%) Frame = -2 Query: 261 WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQN 88 W++ +ERE + N +S E E+ E+E D + + G E++ G E EQ+ Sbjct: 343 WIDD--VLEREDNVDNSESDEDEDSESEEE--EDDDGESDGGDEKQRKGHHLEDWEQS 396 >At1g56110.1 68414.m06443 nucleolar protein Nop56, putative similar to XNop56 protein [Xenopus laevis] GI:14799394; contains Pfam profile PF01798: Putative snoRNA binding domain Length = 522 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/73 (20%), Positives = 33/73 (45%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 ++ K E ++ E ++E ++K R + + E + S K + + + +DG Sbjct: 451 KKAKGEEEEEVVAMEEDKSEKKKKKEK-RKMETAEENEKSEKKKTKKSKAGGEEETDDGH 509 Query: 57 ASADYQTKSKKVE 19 ++ + KSK E Sbjct: 510 STKKKKKKSKSAE 522 >At1g35330.1 68414.m04379 zinc finger (C3HC4-type RING finger) family protein contains Pfam profile: PF00097: Zinc finger, C3HC4 type (RING finger) Length = 327 Score = 27.5 bits (58), Expect = 7.1 Identities = 11/29 (37%), Positives = 20/29 (68%) Frame = -2 Query: 180 ESSTYRDKNRSVNSGSERKSSGKDEEYSE 94 ++ + R+ RS + GSER+ GK++E+ E Sbjct: 288 QARSSREGYRSGSVGSERRGKGKEKEFGE 316 >At1g19990.1 68414.m02504 expressed protein ; expression supported by MPSS Length = 251 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/78 (20%), Positives = 36/78 (46%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 E K+ K+ E +NK S + N+GS++ ++++ + N KS G Sbjct: 5 EDVKAMKMKEEAEEDNKSLSSFAKKKPTNGNNAGSKKLKKEENDDDDDDNKPIKSSVSGS 64 Query: 57 ASADYQTKSKKVEKNSAR 4 + + K ++++K+ + Sbjct: 65 RAKPVK-KKEEIDKDDEK 81 >At1g19880.1 68414.m02493 regulator of chromosome condensation (RCC1) family protein low similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 538 Score = 27.5 bits (58), Expect = 7.1 Identities = 16/45 (35%), Positives = 22/45 (48%), Gaps = 3/45 (6%) Frame = -3 Query: 356 DDSDKNR---GKDTDDKYSETGTNKSSETKTGKRDGSRAASQSKG 231 D+SDK + G D D YSE G E GK+ +R + +G Sbjct: 471 DNSDKEKEVQGSDADSDYSEDG-----EEANGKKQSARGRGRGRG 510 >At5g66950.1 68418.m08440 expressed protein Length = 870 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 64 REKS+ N R N++ S R RSV+ G S DE+ E S+ ++D Sbjct: 631 REKSQYNG-GRLLVNEDEHPSKRRVSFRSVDHGEASVISLGDEDEEEDGSNGVEWDD 686 >At5g61330.1 68418.m07696 rRNA processing protein-related contains weak similarity to rRNA processing protein EBP2 (EBNA1-binding protein homolog) (Swiss-Prot:P36049) [Saccharomyces cerevisiae] Length = 436 Score = 27.1 bits (57), Expect = 9.4 Identities = 23/83 (27%), Positives = 32/83 (38%), Gaps = 4/83 (4%) Frame = -2 Query: 255 ESGVTVEREKSESNKKSREFENKE---AESSTYRDKN-RSVNSGSERKSSGKDEEYSEQN 88 + G T E ++ +S + E ENKE ES + D N + SG E KD + E Sbjct: 60 DEGDTEEDDEGDSEEDD-EGENKEDEDGESEDFEDGNDKESESGDEGNDDNKDAQMEELE 118 Query: 87 SSNKSFNDGDASADYQTKSKKVE 19 K + K K E Sbjct: 119 KEVKELRSQEQDILKNLKRDKGE 141 >At5g59730.1 68418.m07487 exocyst subunit EXO70 family protein leucine zipper-containing protein, Lycopersicon esculentum, PIR:S21495 contains Pfam domain PF03081: Exo70 exocyst complex subunit; Length = 634 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/65 (26%), Positives = 28/65 (43%), Gaps = 1/65 (1%) Frame = -2 Query: 240 VEREKSESNKKSREFENKEAES-STYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFND 64 +E E K +RE+ + E S +YR S ++ + S + Y E F+ Sbjct: 102 LESEFHRVLKANREYLDPECVSVRSYRSSRFSTSTTTSVSDSEDESSYEENADEEHRFSG 161 Query: 63 GDASA 49 GD+ A Sbjct: 162 GDSDA 166 >At5g55660.1 68418.m06940 expressed protein similar to unknown protein (pir||T08929) Length = 778 Score = 27.1 bits (57), Expect = 9.4 Identities = 22/74 (29%), Positives = 34/74 (45%), Gaps = 5/74 (6%) Frame = -2 Query: 252 SGVTVEREKSESN----KKSREFENKEAES-STYRDKNRSVNSGSERKSSGKDEEYSEQN 88 SG V+ K E + K + E K+ E S DK V E+K G+D+E E + Sbjct: 37 SGKEVQESKKEEDTGLEKMEIDDEGKQHEGESETGDKEVEVTE-EEKKDVGEDKEQPEAD 95 Query: 87 SSNKSFNDGDASAD 46 ++ +D + AD Sbjct: 96 KMDEDTDDKNLKAD 109 >At5g51410.2 68418.m06374 LUC7 N_terminus domain-containing protein similar to cisplatin resistance-associated overexpressed protein [Homo sapiens] GI:6899846; contains Pfam profile PF03194: LUC7 N_terminus Length = 334 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/76 (22%), Positives = 31/76 (40%) Frame = -2 Query: 228 KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 49 K + ++ R KEA+ + K R S S+R S E Y +++ + D Sbjct: 236 KDKGKEEERLVRGKEADD---KRKPREKESESKRSGSSDRERYRDRDRNRDGDRHRDRGR 292 Query: 48 DYQTKSKKVEKNSARD 1 DY+ + ++ D Sbjct: 293 DYRKPYDRRSRSGRED 308 >At5g51410.1 68418.m06373 LUC7 N_terminus domain-containing protein similar to cisplatin resistance-associated overexpressed protein [Homo sapiens] GI:6899846; contains Pfam profile PF03194: LUC7 N_terminus Length = 334 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/76 (22%), Positives = 31/76 (40%) Frame = -2 Query: 228 KSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASA 49 K + ++ R KEA+ + K R S S+R S E Y +++ + D Sbjct: 236 KDKGKEEERLVRGKEADD---KRKPREKESESKRSGSSDRERYRDRDRNRDGDRHRDRGR 292 Query: 48 DYQTKSKKVEKNSARD 1 DY+ + ++ D Sbjct: 293 DYRKPYDRRSRSGRED 308 >At5g48610.1 68418.m06012 expressed protein ; expression supported by MPSS Length = 470 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/65 (23%), Positives = 28/65 (43%) Frame = -2 Query: 201 EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 22 EF++K E +DK + + K KD++ + +K + D + K K + Sbjct: 10 EFQDKYKEKKHKKDKEKREGKEKKSKDRSKDKQKERKEKKDKHKDQKDKEKG-KEKGKPL 68 Query: 21 EKNSA 7 E+ A Sbjct: 69 EEKKA 73 >At5g44800.1 68418.m05492 chromodomain-helicase-DNA-binding family protein / CHD family protein similar to chromatin remodeling factor CHD3 (PICKLE) [Arabidopsis thaliana] GI:6478518; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00628: PHD-finger, PF00385: 'chromo' (CHRromatin Organization MOdifier) Length = 2228 Score = 27.1 bits (57), Expect = 9.4 Identities = 19/74 (25%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = -2 Query: 231 EKSESNKKSREFENKEAESS-TYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 55 EK +S +++ K + +YR+ SG +S G+DE+ E + G A Sbjct: 1322 EKYQSEEEAALGRGKRLRKAVSYREAYAPHTSGPVNESGGEDEKEPEPELKKEYTPAGRA 1381 Query: 54 SADYQTKSKKVEKN 13 + TK ++ +KN Sbjct: 1382 LKEKFTKLRERQKN 1395 >At5g37010.1 68418.m04438 expressed protein Length = 637 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -2 Query: 207 SREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSE--QNSSNKSFNDGD 58 SRE ++ ++ S R++ S N G R+ S SE NSS S N + Sbjct: 186 SRERDDSKSNRSGSRERGSSGNGGGSRRVSRSPGRRSEINPNSSGNSVNSSN 237 >At5g08610.1 68418.m01024 DEAD box RNA helicase (RH26) strong similarity to RNA helicase RH26 [Arabidopsis thaliana] GI:3776025; contains Pfam profiles PF00270: DEAD/DEAH box helicase, PF00271: Helicase conserved C-terminal domain; identical to cDNA DEAD box RNA helicase, RH26 GI:3776024 Length = 850 Score = 27.1 bits (57), Expect = 9.4 Identities = 18/79 (22%), Positives = 40/79 (50%), Gaps = 1/79 (1%) Frame = -2 Query: 240 VEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDG 61 V+ + SES+ + R N ++ SS +++V+SGS + S + +S + Sbjct: 189 VQGKSSESSFRGRSDRNVDSGSSFRGRSDKNVDSGSSFRGRNDRNVDSGSSFRGRSDRNV 248 Query: 60 DASADYQTKS-KKVEKNSA 7 D+ + ++ +S + V+ S+ Sbjct: 249 DSGSSFRGRSDRNVDSGSS 267 >At5g03680.1 68418.m00327 trihelix DNA-binding protein, putative similar to DNA-binding protein DF1 [Pisum sativum] GI:13646986 Length = 591 Score = 27.1 bits (57), Expect = 9.4 Identities = 15/75 (20%), Positives = 35/75 (46%) Frame = -2 Query: 261 WLESGVTVEREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 82 W+ +G+ +EK + NKK ++ + ++N N+ + + +EQ + Sbjct: 480 WISNGM--RKEKKQINKKRKDNSSSCGVYYPRNEENPIYNNRESGYNDNDPHQINEQGNV 537 Query: 81 NKSFNDGDASADYQT 37 S ++ +A+A+ T Sbjct: 538 GSSTSNANANANVTT 552 >At4g37210.2 68417.m05267 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q02508 Protein HGV2 Halocynthia roretzi; contains Pfam profile PF00515 TPR Domain Length = 377 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 55 +++ E ++S E+ A S D R +S + S GKD+ ++ + +D D Sbjct: 148 KKEGEVQQESSNGESL-APSVVSGDPERQGSSSGQEGSGGKDQGEDGEDCQDDDLSDADG 206 Query: 54 SAD 46 AD Sbjct: 207 DAD 209 >At4g37210.1 68417.m05268 tetratricopeptide repeat (TPR)-containing protein low similarity to SP|Q02508 Protein HGV2 Halocynthia roretzi; contains Pfam profile PF00515 TPR Domain Length = 492 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/63 (25%), Positives = 29/63 (46%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDA 55 +++ E ++S E+ A S D R +S + S GKD+ ++ + +D D Sbjct: 148 KKEGEVQQESSNGESL-APSVVSGDPERQGSSSGQEGSGGKDQGEDGEDCQDDDLSDADG 206 Query: 54 SAD 46 AD Sbjct: 207 DAD 209 >At4g29060.1 68417.m04157 elongation factor Ts family protein similar to SP|P35019 Elongation factor Ts (EF-Ts) {Galdieria sulphuraria}; contains Pfam profiles PF00627: UBA/TS-N domain, PF00889: Elongation factor TS, PF00575: S1 RNA binding domain Length = 953 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = -3 Query: 332 KDTDDKYSETGTNKSSETKTGKRDGSRAASQSKGKNPN 219 ++ DD GKRDGS+ Q KG+ N Sbjct: 205 RENDDPPKRQSGGSDKPRSGGKRDGSKGGGQRKGEGFN 242 >At3g45090.2 68416.m04862 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 698 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/76 (22%), Positives = 32/76 (42%), Gaps = 1/76 (1%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF-NDG 61 + + E + E ++ E S ++NR + +S+ DEEY + +KS+ D Sbjct: 541 DEDDEEGDDDFHEPDSDEDLSDNNDERNRDEIGSVDEESTKSDEEYDDLAMEDKSYWTDN 600 Query: 60 DASADYQTKSKKVEKN 13 + T S + N Sbjct: 601 EEEESRDTISMVSQNN 616 >At3g45090.1 68416.m04863 2-phosphoglycerate kinase-related contains weak similarity to 2-phosphoglycerate kinase (GI:467751) [Methanothermus fervidus] Length = 717 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/76 (22%), Positives = 32/76 (42%), Gaps = 1/76 (1%) Frame = -2 Query: 237 EREKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF-NDG 61 + + E + E ++ E S ++NR + +S+ DEEY + +KS+ D Sbjct: 560 DEDDEEGDDDFHEPDSDEDLSDNNDERNRDEIGSVDEESTKSDEEYDDLAMEDKSYWTDN 619 Query: 60 DASADYQTKSKKVEKN 13 + T S + N Sbjct: 620 EEEESRDTISMVSQNN 635 >At3g11590.1 68416.m01416 expressed protein Length = 622 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = -2 Query: 216 NKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSF 70 N+++ ++ N +Y ++ V +G+E S D E N NKS+ Sbjct: 461 NEEAGDYLNHHISFGSYNIEDGEVENGNEEGSGESDLHSIELNIDNKSY 509 >At2g39260.1 68415.m04821 MIF4G domain-containing protein similar to hUPF2 [Homo sapiens] GI:12232320; contains Pfam profile PF02854: MIF4G domain Length = 1186 Score = 27.1 bits (57), Expect = 9.4 Identities = 18/67 (26%), Positives = 34/67 (50%) Frame = -2 Query: 201 EFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGDASADYQTKSKKV 22 E E K E S + K + S SE + + E + + S++ + D ++A+ + ++V Sbjct: 372 EAEPKSNEQSA-KAKEKLSESSSEVVENQQTTEDTTEVSADSASMDDRSNAEQPKEKEEV 430 Query: 21 EKNSARD 1 EK A+D Sbjct: 431 EKEKAKD 437 >At2g35210.1 68415.m04319 human Rev interacting-like family protein / hRIP family protein similar to ARFGAP1 protein GI:7211442 from [Homo sapiens]; contains InterPro accession IPR001164: Human Rev interacting-like protein (hRIP) Length = 395 Score = 27.1 bits (57), Expect = 9.4 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = -2 Query: 222 ESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKSFNDGD 58 E+++ ++F N ++ SS N + ++ E KSS K S SS F DGD Sbjct: 294 ETDEARKKFTNAKSISSAQYFGNDNNSADLEAKSSLKKFSGSSAISSADLFGDGD 348 >At1g80930.1 68414.m09495 MIF4G domain-containing protein / MA3 domain-containing protein similar to SP|Q9P6R9 Cell cycle control protein cwf22 {Schizosaccharomyces pombe}; contains Pfam profiles PF02854: MIF4G domain, PF02847: MA3 domain Length = 900 Score = 27.1 bits (57), Expect = 9.4 Identities = 20/83 (24%), Positives = 34/83 (40%), Gaps = 5/83 (6%) Frame = -2 Query: 234 REKSESNKKSREFENKEAESSTYRDKNRSVNSGSE----RKSSGKDEEYSEQNSSNKSFN 67 +++ E+N S + K E + D R VN G R + DEE + + + Sbjct: 91 KDRKEANSGSEDDRGKRIEVDSDGDGERRVNKGRNTDRVRADTSSDEEDDLKGNKKEPME 150 Query: 66 -DGDASADYQTKSKKVEKNSARD 1 D D + +S KV + R+ Sbjct: 151 VDDDYGRRGRRRSPKVMEKQGRE 173 >At1g66050.1 68414.m07497 zinc finger (C3HC4-type RING finger) family protein contains zinc finger, C3HC4 type (RING finger), signature, PROSITE:PS00518 Length = 623 Score = 27.1 bits (57), Expect = 9.4 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -2 Query: 111 DEEYSEQNSSNKSFNDGDASADYQTKSKKVEKNS 10 +EE SSN S +G+ ++ TK K++KNS Sbjct: 582 EEEAEVAESSNISEEEGEEESEPPTKKIKMDKNS 615 >At1g63420.1 68414.m07172 expressed protein Length = 578 Score = 27.1 bits (57), Expect = 9.4 Identities = 16/46 (34%), Positives = 24/46 (52%) Frame = -2 Query: 219 SNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSS 82 S KKS E + S++ ++NRS S S SG ++ +E N S Sbjct: 125 SEKKSPEETGSSVDCSSFLNQNRS-GSCSRTLQSGYNQNQTESNRS 169 >At1g26680.1 68414.m03250 transcriptional factor B3 family protein low similarity to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 920 Score = 27.1 bits (57), Expect = 9.4 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 1/48 (2%) Frame = -2 Query: 147 VNSGSERKSSGKDEEYSEQNSSNKSFNDGDASAD-YQTKSKKVEKNSA 7 VNS S SSG D SE+ S ++ D + S D +TK +K +S+ Sbjct: 841 VNSLSSNPSSGDDSSRSEE-SEEENMEDKNISQDCLETKKRKYCSSSS 887 >At1g22882.1 68414.m02857 expressed protein Length = 660 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/53 (22%), Positives = 26/53 (49%) Frame = -2 Query: 231 EKSESNKKSREFENKEAESSTYRDKNRSVNSGSERKSSGKDEEYSEQNSSNKS 73 +KSE N + + + + + +++ +G+ + D E+ EQN NK+ Sbjct: 154 KKSEINNTGTWNDTEGKDDNNFLKQSQLNKTGTGNDTESSDNEFLEQNQMNKT 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,732,028 Number of Sequences: 28952 Number of extensions: 141345 Number of successful extensions: 1247 Number of sequences better than 10.0: 120 Number of HSP's better than 10.0 without gapping: 1029 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1230 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1180950720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -