BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0309.Seq (548 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1762 - 39716723-39717016,39717256-39717332,39717452-397174... 27 7.5 >01_06_1762 - 39716723-39717016,39717256-39717332,39717452-39717498, 39717953-39718053,39718271-39718360,39718556-39720133 Length = 728 Score = 27.5 bits (58), Expect = 7.5 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = -3 Query: 282 IAVNSYPQRPSPSAEHARGAVTLSHKGKRSF 190 I ++ +PQ PSP A H+ VT S G RS+ Sbjct: 437 IHISGHPQEPSPRAAHS-APVTPSSAGCRSW 466 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,439,073 Number of Sequences: 37544 Number of extensions: 223622 Number of successful extensions: 446 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1233951264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -