SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0305.Seq
         (499 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AK055979-1|BAB71063.1|  710|Homo sapiens protein ( Homo sapiens ...    33   0.55 

>AK055979-1|BAB71063.1|  710|Homo sapiens protein ( Homo sapiens
           cDNA FLJ31417 fis, clone NT2NE2000327, weakly similar to
           GLUCOAMYLASE S1/S2 PRECURSOR (EC 3.2.1.3). ).
          Length = 710

 Score = 33.1 bits (72), Expect = 0.55
 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 1/70 (1%)
 Frame = +3

Query: 39  AQKVQDPVHPAVAALMDIAPAIVVEAYHPPAVPATLIQAQRMQDPVHLAVAA-LMDIALA 215
           A   Q  V   +   +   P +      PPAV AT + A R Q PV    AA   D AL 
Sbjct: 232 AATAQPAVQHIIHQPIQSRPPVTTSNAIPPAVVAT-VSATRAQSPVITTTAAHATDSALR 290

Query: 216 IVVEVYHPPA 245
             + + HPP+
Sbjct: 291 PTLSIQHPPS 300


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 63,240,233
Number of Sequences: 237096
Number of extensions: 1265910
Number of successful extensions: 2112
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1893
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2110
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4536472160
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -