BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0305.Seq (499 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK055979-1|BAB71063.1| 710|Homo sapiens protein ( Homo sapiens ... 33 0.55 >AK055979-1|BAB71063.1| 710|Homo sapiens protein ( Homo sapiens cDNA FLJ31417 fis, clone NT2NE2000327, weakly similar to GLUCOAMYLASE S1/S2 PRECURSOR (EC 3.2.1.3). ). Length = 710 Score = 33.1 bits (72), Expect = 0.55 Identities = 23/70 (32%), Positives = 30/70 (42%), Gaps = 1/70 (1%) Frame = +3 Query: 39 AQKVQDPVHPAVAALMDIAPAIVVEAYHPPAVPATLIQAQRMQDPVHLAVAA-LMDIALA 215 A Q V + + P + PPAV AT + A R Q PV AA D AL Sbjct: 232 AATAQPAVQHIIHQPIQSRPPVTTSNAIPPAVVAT-VSATRAQSPVITTTAAHATDSALR 290 Query: 216 IVVEVYHPPA 245 + + HPP+ Sbjct: 291 PTLSIQHPPS 300 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 63,240,233 Number of Sequences: 237096 Number of extensions: 1265910 Number of successful extensions: 2112 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1893 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2110 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4536472160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -