BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= msgV0304.Seq
(602 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q25802 Cluster: RpoD protein; n=2; Plasmodium|Rep: RpoD... 33 5.2
>UniRef50_Q25802 Cluster: RpoD protein; n=2; Plasmodium|Rep: RpoD
protein - Plasmodium falciparum
Length = 960
Score = 33.1 bits (72), Expect = 5.2
Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
Frame = -2
Query: 148 NVHNIWSLVYFK*LE*NYSF-SRH*RNSRSYFVLFNFNNVIYLNEIQYI 5
N N++S Y+K NY+F + + + F+L NFNN+ LN++ Y+
Sbjct: 497 NYFNLFSNYYYKIYNNNYNFINSNYYFKKMNFILKNFNNIQILNKLFYV 545
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 492,498,426
Number of Sequences: 1657284
Number of extensions: 8855629
Number of successful extensions: 15722
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 15274
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15721
length of database: 575,637,011
effective HSP length: 97
effective length of database: 414,880,463
effective search space used: 42732687689
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -