BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0304.Seq (602 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g52460.1 68418.m06509 F-box family protein contains F-box dom... 27 7.2 At1g33750.1 68414.m04172 terpene synthase/cyclase family protein... 27 9.6 >At5g52460.1 68418.m06509 F-box family protein contains F-box domain Pfam:PF00646 Length = 369 Score = 27.5 bits (58), Expect = 7.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -2 Query: 493 KVIRDVEVSVVEFSMNFCLFFNIIFKDKSS 404 K+I DV SV S+N F ++FKD++S Sbjct: 119 KIIVDVPSSVCLPSLNILRLFYVVFKDENS 148 >At1g33750.1 68414.m04172 terpene synthase/cyclase family protein similar to DELTA-CADINENE SYNTHASE ISOZYME A GB:Q43714 from [Gossypium arboreum] Length = 603 Score = 27.1 bits (57), Expect = 9.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 233 LHYTRIYETLTFWDYELDFPGRL 301 LHY R +TLT W ++D P +L Sbjct: 293 LHYVRELKTLTKWWKDIDLPYKL 315 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,717,882 Number of Sequences: 28952 Number of extensions: 192796 Number of successful extensions: 326 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 324 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 326 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1197101088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -