BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0303.Seq (612 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1834.01 |sup45||translation release factor eRF1|Schizosaccha... 79 5e-16 SPBPB7E8.02 |||PSP1 family protein|Schizosaccharomyces pombe|chr... 27 2.1 SPBC56F2.01 |pof12||F-box protein Pof12|Schizosaccharomyces pomb... 26 4.9 SPBC1347.06c |cki1||serine/threonine protein kinase Cki1|Schizos... 25 8.6 SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces po... 25 8.6 >SPAC1834.01 |sup45||translation release factor eRF1|Schizosaccharomyces pombe|chr 1|||Manual Length = 433 Score = 79.0 bits (186), Expect = 5e-16 Identities = 48/94 (51%), Positives = 61/94 (64%), Gaps = 1/94 (1%) Frame = +3 Query: 333 MSEESSADRNVEIWKIKKLIKSLEMARGNGTSMISLIIPPKDQISRVSKMLADEFGTAS- 509 MSE +A++ +EIWKI++L+K L GNGTSMI+LIIPP +QISR S MLA+E+GTAS Sbjct: 1 MSE--TAEKAIEIWKIRRLVKQLINCHGNGTSMITLIIPPGEQISRYSNMLAEEYGTASN 58 Query: 510 ISSHV*IVSQCFGAILXSXPTQSCILKXHPNGLV 611 I S V +S AI + K NGLV Sbjct: 59 IKSRVNRLS-VLSAITSTRERLKLYNKVPDNGLV 91 >SPBPB7E8.02 |||PSP1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 749 Score = 27.1 bits (57), Expect = 2.1 Identities = 16/41 (39%), Positives = 21/41 (51%), Gaps = 2/41 (4%) Frame = +3 Query: 312 LNKKRNKMSEE--SSADRNVEIWKIKKLIKSLEMARGNGTS 428 LN+ N +S SSAD +E W K I S + +R TS Sbjct: 10 LNRLNNGLSSNNGSSADEGLEHWNPLKKIHSADSSRRRSTS 50 >SPBC56F2.01 |pof12||F-box protein Pof12|Schizosaccharomyces pombe|chr 2|||Manual Length = 440 Score = 25.8 bits (54), Expect = 4.9 Identities = 11/25 (44%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -2 Query: 332 FVSLFI*LINHKHYIC-INN*NNVF 261 F + F+ L +HK+YIC + N NN++ Sbjct: 197 FSTKFVALSSHKNYICGLTNDNNLY 221 >SPBC1347.06c |cki1||serine/threonine protein kinase Cki1|Schizosaccharomyces pombe|chr 2|||Manual Length = 446 Score = 25.0 bits (52), Expect = 8.6 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 201 QTALI*FEPDGRDTSRLRSHFLVYIYVCGCS 109 Q I FEP D +LR + Y + GC+ Sbjct: 36 QQVAIKFEPRRSDAPQLRDEYRTYKLLAGCT 66 >SPBC887.04c |lub1||WD repeat protein Lub1|Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 25.0 bits (52), Expect = 8.6 Identities = 9/18 (50%), Positives = 15/18 (83%) Frame = +3 Query: 348 SADRNVEIWKIKKLIKSL 401 SAD+ ++IW +KL+KS+ Sbjct: 155 SADKLIKIWNGEKLVKSI 172 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,511,840 Number of Sequences: 5004 Number of extensions: 49776 Number of successful extensions: 139 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 267622334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -