BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0299.Seq (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z35598-5|CAA84652.1| 628|Caenorhabditis elegans Hypothetical pr... 28 4.4 AL031630-2|CAA21000.1| 310|Caenorhabditis elegans Hypothetical ... 27 7.7 AF067219-7|AAC17026.2| 372|Caenorhabditis elegans Innexin prote... 27 7.7 >Z35598-5|CAA84652.1| 628|Caenorhabditis elegans Hypothetical protein F10F2.7 protein. Length = 628 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -2 Query: 435 VEADTCLYRSKKDGRNRTSTMRYGEEVV 352 +E D C ++ K N+ S RY EE V Sbjct: 84 IEGDKCTFKFPKASNNKESAQRYCEETV 111 >AL031630-2|CAA21000.1| 310|Caenorhabditis elegans Hypothetical protein Y38H6C.2 protein. Length = 310 Score = 27.5 bits (58), Expect = 7.7 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = -3 Query: 428 PIRVCIARRKMGATVPALCVTVRKLSDIFIHYARFECNVFYHFMI 294 PI + + A+ PA+ T+R L DIF + V HF+I Sbjct: 224 PIGILYISTGLLASHPAIVTTIRYLMDIFTSFVAINATV--HFLI 266 >AF067219-7|AAC17026.2| 372|Caenorhabditis elegans Innexin protein 16 protein. Length = 372 Score = 27.5 bits (58), Expect = 7.7 Identities = 12/20 (60%), Positives = 16/20 (80%) Frame = +3 Query: 93 RENRDDLVFSQWVPF*LVIQ 152 RE R+ +++ QWVPF LVIQ Sbjct: 95 REGRE-MIYYQWVPFLLVIQ 113 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,299,888 Number of Sequences: 27780 Number of extensions: 305014 Number of successful extensions: 596 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 596 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -