BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0295.Seq (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 prot... 25 0.65 AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 21 6.1 >DQ659248-1|ABG47446.1| 496|Tribolium castaneum chitinase 8 protein. Length = 496 Score = 24.6 bits (51), Expect = 0.65 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +1 Query: 142 PVSIAIQPTDPSCSERPRPTRTSDA 216 P + QPT+ S +++P+ T+T ++ Sbjct: 411 PTQASEQPTESSTTQKPQTTKTPES 435 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 21.4 bits (43), Expect = 6.1 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +2 Query: 158 SNPQTRAAARGLVLREPATRRDALSLKPFPRDIVAGIRRTVSL 286 S P+TRA L + ALS+ + + I A I T S+ Sbjct: 22 SRPKTRAKIYALCVVTALVTPSALSIIYYRQPIYAKISETKSI 64 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,769 Number of Sequences: 336 Number of extensions: 2300 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -